(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE243

PENCW_16.PE243       Location/Qualifiers
FT   CDS_pept        join(complement(552323..552784),complement(550833..552217),
FT                   complement(548826..550761))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824375"
FT                   /orf_name="Pc20g02430"
FT                   /product="Pc20g02430 protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85572.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI0001831839"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE5"
FT                   /transl_table=1
FT                   /translation="MDLPRARQDGLHNADRRARELYRYYKPASQAEVVPTWLPANDGFP
FT                   FTANSGNIITPPISEGSVPSHSPPSRPASAGSEALVLGTSNSTMTSFAQLAALRLNAER
FT                   VFVSVLDRDQQHIIAEATKSVNLNDPSIHDDNDNIWLGTSDTRKAWSVCKDIVSLPPND
FT                   RKNADYQFLIVNDMTENERYKHLSFVEKDPNFRFFAGTPLTTERNINLGCFFVLDKKPR
FT                   DGLTPLEKDTLGSISMLVMDYLRVCRQASEGRRAARLSRGLSYFVEGSSSFVDNVDPSR
FT                   TDSVGHLSATPASSYNRISASSRSHGDGSENASQAPSNSPPNDRSLSNDARSFSSVPSD
FT                   LKLDYDWKLGSGSKLDNGSNVESGTVESSLPEWLTSSSRNRLPPDDSQGTSWSFRRAAN
FT                   LLRESLDLSGDGGVIFLEANNSPLMDADMGGDCSDTGGPASVLSASTNEEPFAPQAGSM
FT                   TTCPAANLDRSFLQLLLRRYPKGKLWSFHRDGLISTSDDDDQEAQDKGPLGTSATSRSP
FT                   PNAQPSKPTRKRRKAAENSVLNQYFPHAAQIMFVPLWDAVSSQWFGGCFCWSTIETQVF
FT                   TTSVELSSVLGFSSSIMAEYSRVESLIADRQKGDFIGSISHELRSPLHGILAAAEFLNS
FT                   THLNEFQDSLLETINSCGRTLLDTMNQVLDFSKVVSLERTWRSMKRKKESQLDYKGSDK
FT                   LPHHLDTLVATDVAILAEEVVEGICLGNVYGQSSTASADLPVLMPHQTKSQHQRSNVEV
FT                   VIDVPFRDWVYRTQPGALRRIIMNIFGNAMKYTEFGRVTLSLAASSQSEGRSRRQGLED
FT                   LVTLTVTDTGKGISEEFLRGKLYTPFAQEDALAVGTGLGLSIVRSLVKALNGSIRIRSR
FT                   PGEGTVVRVSLPLERPVGKESPEIEPSGQLMQQRETLTQTLLLREGYLGRRASIWGIDP
FT                   SEVTANSNWSEIARYLSEWYDIEIVAWTPDAHIDLVLMDENDLPNFRTIAPSATLPALL
FT                   VLCHKSVDYTGSKSEWLSLANSVNIIRRPCGPHKLARSVMRCLTHGQPRSTTPASALQP
FT                   LNLPIRTSSLPSELASPHMSTGDDIGAPEQDCPGGRPMTVSPLRQPSPMTALKEEISEA
FT                   PLPDPLVEGAKPSRRLARVLVVDDNRINLNLMMTFLKKRQLTDLDPAENGKLAVEAVER
FT                   MQSGYDIIFMDMSMPVMNGFEATRAIRSLERDTDGRKPAIIIALTGLSSSRDESDAIAS
FT                   GVDLFLTKPVSFREVARLLNEWERGELVTERKMTC"
     atggatcttc ctagggcgcg ccaggatggc ctacacaatg cggatcgcag ggcgagagag        60
     ctgtaccgct actacaagcc tgcttcccaa gccgaagtgg tgcctacttg gcttcctgcg       120
     aacgatggat tcccctttac tgcaaattca ggaaatataa tcaccccacc gatatcagaa       180
     ggctcagtgc cttcgcatag tccaccttca cgaccagcga gcgcaggctc cgaagccctc       240
     gttttaggta cctcaaacag tacaatgacg tcatttgccc agctagcggc cttgcggctg       300
     aatgcggaga gggtgtttgt ctctgtattg gatcgtgatc aacagcacat cattgccgaa       360
     gctacgaagt ccgtcaattt gaacgatccg tcaatccacg acgacaatga caatatctgg       420
     ttggggacat ccgacacccg caaggcatgg agtgtatgca aggacatcgt ttccctaccc       480
     cccaacgacc gcaaaaatgc agattatcaa tttctaattg tgaacgacat gaccgaaaat       540
     gagcgctaca aacacctttc cttcgttgaa aaagatccca acttccgctt tttcgctgga       600
     actcccttga caaccgagag gaatatcaat ttgggctgtt ttttcgtgtt ggataaaaag       660
     ccccgggatg gattgacgcc actggagaag gatacgctgg gatctatatc gatgcttgtg       720
     atggactact tgagggtgtg caggcaggct tccgaaggac gccgggctgc acgcctttcc       780
     cgcgggctca gctatttcgt tgaaggaagc tccagttttg tggataatgt cgacccgtcg       840
     cgcaccgaca gtgtcggcca tttatcagca actccggcat cttcctacaa tcgaatcagt       900
     gcctctagtc gatcccatgg agacggctca gaaaacgcat cgcaagcacc gtccaatagt       960
     ccaccaaacg accggtcact cagtaacgac gcacgttcct tcagctctgt tccttcggat      1020
     ttgaaactgg actacgattg gaagttgggc agtggttcaa aattggacaa cggctcaaat      1080
     gttgaatcgg gcacggtgga gagctctctg ccagaatggc tgacaagcag cagccgaaat      1140
     cgactaccgc cggatgattc tcaaggcacc tcttggtcct tccgcagggc tgccaactta      1200
     cttcgcgaga gccttgactt gagtggcgac ggtggggtga ttttcctgga ggccaacaat      1260
     agccctttga tggatgccga tatgggaggt gattgctccg acacaggcgg acctgcctct      1320
     gtcctgtcgg catcaacaaa tgaagagccg tttgctcccc aggcaggttc gatgaccaca      1380
     tgccctgctg ccaacttgga tcgatccttc ctgcaattgc tgcttcgacg ttaccccaaa      1440
     ggaaagctat ggtctttcca tcgcgatggg ctcatctcga catccgatga tgacgaccaa      1500
     gaagcccaag acaagggtcc tcttggcacc agtgccacca gtcggtcccc acccaatgca      1560
     caaccttcaa agccaacgcg aaaacggcgg aaagccgcgg agaattcagt actcaaccag      1620
     tattttccac atgccgcaca aataatgttt gtgcccctgt gggatgctgt ttcttcgcaa      1680
     tggtttggag ggtgtttctg ctggagcaca attgagaccc aggtgttcac cacctcggtc      1740
     gagctcagct cagtgcttgg cttttcatcg tccatcatgg ccgaatacag ccgtgttgaa      1800
     tccctcatcg cggatcgcca gaagggtgat ttcatcggga gtatctcaca tgaactccgt      1860
     agccctctcc atggcatctt ggccgctgct gagtttttga acagcactca tctaaacgaa      1920
     ttccaggact cattgcttga aaccatcaat tcctgtggcc ggacgttgct ggatacaatg      1980
     aaccaggtac ttgacttcag caaagtggta tctttggaac ggacatggcg gtcaatgaaa      2040
     cgcaagaaag agtcacagct cgattacaaa ggatcggaca agctgccgca tcatctggat      2100
     acgctcgtgg ctaccgatgt ggcgattctt gccgaggaag tcgttgaagg catctgcctt      2160
     ggcaatgtgt atggccagag ctcgactgct tcagctgacc tgcccgtgtt gatgccacat      2220
     cagacaaagt cacagcatca gcggtccaat gtcgaagtcg ttattgacgt tccattccgg      2280
     gattgggtct accgaactca gccaggcgct ttgcggcgga tcattatgaa tatttttgga      2340
     aacgccatga aatatacaga atttggacgt gtcacattat ccttggcagc atcgagccag      2400
     tctgaaggac gatctcgacg gcaaggcctc gaagacttgg tcacattgac agtaaccgac      2460
     acagggaaag gtatatcgga ggagtttttg cgcggcaagc tttacacgcc ctttgctcag      2520
     gaagacgccc tagccgttgg taccggactt ggattatcaa ttgttcgcag tttggtaaag      2580
     gctttgaatg gaagcattcg aattcgcagt cggccggggg aaggcactgt cgtacgtgta      2640
     tcgctcccgc tagagcggcc tgttggcaag gaaagcccag agatcgaacc atccggacag      2700
     ctcatgcaac agagagagac cttaacacaa actcttctgc tacgcgaggg gtaccttggt      2760
     agacgagcct ctatctgggg tatcgatccg tccgaggtga ctgccaactc taactggtct      2820
     gagattgctc gatacctttc agagtggtac gatatcgaga tcgtcgcatg gacaccggac      2880
     gcccatattg atcttgtgct tatggatgaa aacgatttac caaactttcg caccattgca      2940
     ccttcggcca ctttgcctgc tcttctcgtc ctatgccaca agtctgtgga ttacaccgga      3000
     tcaaaatccg agtggttgtc tcttgctaac tccgtgaaca tcatccgtcg cccctgtggg      3060
     ccacataaat tagctcgaag cgtaatgagg tgcctgaccc acggccaacc gagatccacg      3120
     acaccggctt ccgctctgca accactgaat ctgccgatca ggacgtcctc attgccatcc      3180
     gaactcgcct caccccacat gtccactggt gatgatattg gcgcacctga gcaggactgc      3240
     cccggagggc gccctatgac ggtatcaccg ctgcgacaac cgtcgccgat gacggcgtta      3300
     aaggaggaga tttcagaagc cccgttacca gatccactgg tagagggcgc aaagccctcg      3360
     cggcgactgg cacgagtgct cgtggtcgat gacaatcgca tcaacctcaa tttgatgatg      3420
     acgttcctca aaaagcgcca gctgactgac ctggacccag ctgagaatgg caaattggcc      3480
     gttgaggcgg tcgagcgcat gcagagtggt tacgacatta tcttcatgga tatgtcaatg      3540
     cccgtcatga atggtttcga ggctactcgt gctattcgct cgctggagag ggatacagat      3600
     ggccgcaaac cggctatcat cattgcctta accggtctca gtagctctcg tgatgagtcg      3660
     gatgctatag cttctggtgt ggatctattc cttactaaac cggtctcttt cagagaagta      3720
     gcacggctac taaatgagtg ggaaaggggc gagttggtga ctgaacggaa gatgacatgt      3780
     tga                                                                    3783
//

If you have problems or comments...

PBIL Back to PBIL home page