(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE244

PENCW_16.PE244       Location/Qualifiers
FT   CDS_pept        join(complement(555544..555774),complement(555376..555487),
FT                   complement(555055..555317),complement(554662..555004),
FT                   complement(554541..554603),complement(554286..554490),
FT                   complement(553864..554215))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200355" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947802"
FT                   /orf_name="Pc20g02440"
FT                   /product="Pc20g02440 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85573.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183183A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE6"
FT                   /transl_table=1
FT                   /translation="MADDTSDSKSVDVVSAPVREDIKTPSEEPSDNSDDSDGRKPPPLA
FT                   AKLCAVALISCISFGSHWSSGVTGAMKSTMKKEMHIDNVQFSLLEASEDFMATVLLLIS
FT                   GVITDRVGGAQMIVYGNIVYTIGSILVAAAATVRSFDFMIGGRIILALGDIATQIAQYK
FT                   MFSSWFPPSNGFASTLGFELAIGKIGGFIGKSTSNIIASKTGNFAWVFWTAVFMNLFTN
FT                   AASAAFWFFNIYCNRHYKGRRDEATKEQLTEKNKKFEFKKMFELPWMFWAVMGFSIFQT
FT                   SAASVFSQNATELAEKRFNVDSIKAGWYSSLSQYAGFFLVPCLGVFIDVLGNRASVLFI
FT                   CGLGMLLSMVLINFATSHAGTGAAFGIYGIAVSFGPTSVIDSIRTTLWHQSVFGSAYAL
FT                   KVTMNNAMSIIIRIITGALQDADDNSYRRVVQVYLVLGAGATVVGAAILIGSFVTDNLA
FT                   PLQWTRHKRLTSGAAVIERIRERSLVTQRERTRKISILCFAALLLLTVGSWVAYIWGAV
FT                   TGHNS"
     atggcagatg atacctcaga ctcgaagtct gtggacgtgg tgtcggcgcc tgtccgtgaa        60
     gacatcaaga ctccgtcgga agaacctagc gacaacagcg atgactctga tggaaggaag       120
     ccaccgccgc ttgcagcaaa gttatgcgct gtcgcgctga tatcgtgtat tagctttggc       180
     tcgcactgga gttctggcgt gacgggtgct atgaagagca caatgaaaaa ggaaatgcat       240
     atagacaatg ttcaattttc gctcttggaa gctagcgagg attttatggc aacggttctg       300
     cttttgataa gtggtgtgat caccgaccgt gtcggtggag ctcagatgat cgtttatgga       360
     aatatcgtct ataccatcgg ttccatcctc gtcgcggcag cggcgacggt gcgctctttc       420
     gacttcatga tcggaggtcg aatcatcctc gcattgggcg atatcgccac acaaatcgcc       480
     cagtataaaa tgttttcctc ttggtttcct cctagcaatg gatttgcatc cactctaggc       540
     tttgagctcg cgatcggcaa gattggaggg tttattggca agtcaacctc taatattata       600
     gcatcgaaaa ctgggaactt tgcgtgggtg ttttggactg cagtgttcat gaacctgttc       660
     acgaatgccg ccagcgctgc attctggttc ttcaacatat attgtaatcg ccactacaag       720
     ggacgacgcg atgaagccac aaaagaacaa ctgacagaga aaaacaaaaa gttcgaattc       780
     aagaagatgt tcgagctacc ttggatgttc tgggctgtca tgggcttctc tatattccaa       840
     acgagtgctg cgtcagtctt cagccagaat gccaccgaac tggccgagaa gagattcaat       900
     gtcgattcca tcaaggccgg gtggtatagt tctctttcgc agtatgcagg tttcttcctc       960
     gttccctgct tgggcgtgtt cattgatgtc ctcggcaacc gagcatctgt cttgtttatt      1020
     tgcggtcttg gcatgttgtt gagtatggtt ctcattaatt ttgcaacgtc acatgcggga      1080
     acaggggctg cgttcggcat ctacggcatt gccgtgtcct tcggaccaac ctctgtcatc      1140
     gacagcattc gcaccactct ctggcaccaa tcggtctttg gatccgccta tgccctgaag      1200
     gtcaccatga ataatgctat gagcattata attcggatca tcacaggagc tttgcaggat      1260
     gcagacgaca actcataccg ccgggtggtg caggtctacc tagttcttgg tgccggtgct      1320
     acggttgtcg gcgcagctat tctgatcggc tcgtttgtga ctgataacct ggcgccgctg      1380
     cagtggactc ggcataagcg gttgacatcg ggtgcggcgg tcatcgagcg tatccgggag      1440
     cgcagcttgg taacccagcg cgagcgcact cggaagatat ccatactttg ctttgcagct      1500
     ctacttttgc tgacagttgg gtcgtgggtg gcgtatatct ggggtgcggt gaccggtcat      1560
     aattcctag                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page