(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE245

PENCW_16.PE245       Location/Qualifiers
FT   CDS_pept        join(complement(558518..558706),complement(558369..558453),
FT                   complement(557993..558306),complement(557679..557897),
FT                   complement(557428..557624),complement(556632..557376))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824376"
FT                   /orf_name="Pc20g02450"
FT                   /product="Pc20g02450 protein"
FT                   /protein_id="CAP85574.1"
FT                   /db_xref="InterPro:IPR010573"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183183B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE7"
FT                   /transl_table=1
FT                   /translation="MGSLSTTGNEDGKGLQVDHLETANMAHQEQHVETDRAPEAMGREQ
FT                   AELPKGYFYSPYFIGSYCAIGVAFACGTGGYALVAPILTDINNDLGGSGSSDINWVGIV
FT                   YSLTQAIVLMLAGRLSDLFGRRWFFVIGSVIGLVGSIVGARAGTIGQLIAGETLIGIAA
FT                   GFQCSFFWIVSEIVPMKRRFIANSGLFLWTLPTNNTAVQWRGCFYYLTGLNALSVALWF
FT                   FFYHPPSFHMLHRDKTVKQMVLEFDFIGLVLFSAGMILFLIGLNWGGSIYPWKSGQVLG
FT                   TLLSGVAILAVCIAYELKSSLKEPYLPLQLFKNVKYTSCVVWCAIEAMNFYAFGIIWPR
FT                   AVAILYPSLSPASSATMSGLVTMSFALGQMAGPFFANWLPAKPLVIVGTFIGTGLLAAC
FT                   AANPLNLDLTVGVLVTGNLVIGMADGIGLPMTTFPIKNQEALGTAGGLSGCIRLAGTSV
FT                   AVAMYNTILNNRLLQTIPAAVTPVALSAGVPESFIPQLIANLTRTNRVGGGIPGLTAGD
FT                   VPLIQSAFQLGNSQAYSTVFLSTLGFGGVALILCFLIGGVDESNGEYVAALIQHGDGSD
FT                   QQTEKV"
     atgggttctc tgtctaccac tgggaatgaa gatggcaagg ggctacaggt tgaccacctc        60
     gaaacagcga acatggctca ccaagagcaa catgtcgaga ctgaccgcgc ccccgaagcc       120
     atgggaaggg agcaggccga gttgcctaaa gggtactttt acagcccata cttcatcgga       180
     agttactgtg ccattggagt cgcttttgcg tgtggaactg gagggtatgc cttggtagcg       240
     ccgattctga ccgatatcaa taacgacctc ggaggatccg gttcgagtga cattaactgg       300
     gtcggcattg tgtattcctt gacccaggct atcgtgctca tgctggccgg ccgtctgagt       360
     gacctgtttg gccgccgctg gtttttcgtg atcgggtcag tcatcggcct ggttggcagt       420
     atcgtcggtg cgagagccgg cactatcggg cagctcatcg caggggaaac tctgatcggg       480
     attgccgcgg gctttcagtg ctctttcttc tggatcgtgt ccgagattgt gcccatgaag       540
     aggcgcttca tcgccaactc tggactgttt ctgtggactt tgccaacaaa taacactgca       600
     gtgcaatggc gcggatgctt ctactacctg actgggttga atgctctgtc agtagcgctg       660
     tggttcttct tctaccaccc gccatccttc cacatgttac accgcgataa aactgtcaaa       720
     caaatggttc tcgagtttga cttcattggt cttgtattat tttcggccgg catgatcctc       780
     ttcctaattg ggttaaactg gggtggctcg atctacccct ggaagagcgg acaggtattg       840
     ggaaccctgc tctccggtgt cgccattctc gccgtctgta tagcttatga gctgaaatca       900
     tcgctgaaag aaccctacct tcccctccaa ttgttcaaaa atgtcaagta cacttcttgc       960
     gtggtctggt gtgcaattga agccatgaac ttttatgcct ttggaattat ctggcccaga      1020
     gcagttgcca tcctctaccc cagtctaagt ccagccagca gcgcgaccat gtcgggactg      1080
     gtaaccatgt cattcgcgct aggccagatg gcgggcccct ttttcgcaaa ctggctgccg      1140
     gccaaaccac tagtcatcgt gggtacattc atcggcacgg ggctgctcgc ggcctgcgca      1200
     gccaacccac tcaacctaga cctgacggtg ggcgtactcg ttacgggtaa cctcgtgatc      1260
     ggcatggcgg atggaattgg tctgcccatg acgaccttcc caatcaaaaa ccaggaagca      1320
     ttgggcaccg cgggtggtct gagtggatgc attcgcctag cgggcacctc ggtcgcagtg      1380
     gcaatgtata acactatcct gaacaatcgt ctgttacaga cgattcccgc cgccgtcact      1440
     ccagtcgcgc tgtcggcagg tgtgcccgaa tccttcatcc cccagctcat cgccaacctc      1500
     acaagaacca accgggtagg cgggggcatt ccgggtctga ctgctgggga cgtcccgctg      1560
     atccaatctg ccttccaact gggaaactcc caggcgtata gtaccgtctt tctctctacg      1620
     ttgggattcg gcggtgtggc gctgattctg tgctttttga tcggtggtgt cgatgaaagc      1680
     aatggggagt acgtagcagc actaattcag catggggatg gcagcgacca gcagacggaa      1740
     aaagtgtag                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page