(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE246

PENCW_16.PE246       Location/Qualifiers
FT   CDS_pept        join(complement(560424..560496),complement(560196..560343),
FT                   complement(560049..560126),complement(559865..559946),
FT                   complement(559352..559801))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15947803"
FT                   /orf_name="Pc20g02460"
FT                   /product="Pc20g02460 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85575.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000183183C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE8"
FT                   /transl_table=1
FT                   /translation="MASQSAIQESLQSYKTTSTVDDFHSGGDGIGLALVKAVVEFGGHV
FT                   AVIDYREVPHLDLCEIQDLHKESRVKYFSVDITNEMLVTKAFDGILAEFGRIDGVIACA
FT                   GVCVEKPFVDHTWEEVVRLQMVNSVGLFFAVQLAVKAMLKNQPTSGDFTPKGSVILIGS
FT                   IATESGVESQGLTAYSASKGAANGLLRGLAVELAPMGIRVNMISPGHTVTDMSISQFTN
FT                   RPELAMIMRNAVPMGRMGDRRDLKGAAVYFLSDASLYTTGSNLVISGGLHAGRL"
     atggcttcgc aatcggctat ccaagaatcg ctgcagtcgt acaagaccac cagtaccgtg        60
     gacgatttcc atagtggtgg ggatggcatc gggctcgctc tagtcaaggc cgttgtggag       120
     tttggtggcc atgttgcagt gattgactat cgtgaggtgc ctcaccttga tctgtgcgag       180
     attcaagact tgcacaagga gagtcgggtg aagtatttca gtgtcgatat caccaacgag       240
     atgctggtaa ccaaagcatt cgatggaatc ttagcagagt ttgggaggat tgatggtgtg       300
     atagcgtgtg caggtgtttg cgtcgaaaag ccttttgtcg atcatacatg ggaagaggtg       360
     gttcggctcc aaatggtcaa tagcgttgga ctcttcttcg ccgtgcagtt agcggtgaag       420
     gcgatgctta agaatcagcc cacctctggt gatttcaccc cgaagggtag cgttattctc       480
     atcgggagta tcgcgacgga aagtggcgtt gagagccagg gattgacagc ttattcggca       540
     tccaagggag cggctaatgg gttgcttcgt ggtttggccg ttgaacttgc accgatggga       600
     attcgtgtga acatgatctc ccccgggcac actgtcaccg acatgtctat cagtcaattc       660
     acgaatcgtc cggagttggc tatgatcatg cggaatgctg ttcctatggg acggatgggc       720
     gatcgcaggg atctcaaggg tgctgccgtt tatttcctgt cggatgcatc gttgtatact       780
     actggaagta atctagtcat cagcggtggg ctccacgctg gaagattgtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page