(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE247

PENCW_16.PE247       Location/Qualifiers
FT   CDS_pept        560857..561303
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128705"
FT                   /orf_name="Pc20g02470"
FT                   /product="Pc20g02470 protein"
FT                   /protein_id="CAP85576.1"
FT                   /db_xref="UniParc:UPI000183183D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE9"
FT                   /transl_table=1
FT                   /translation="MGTKKFTAREVLDAFYKAEREYMQATPEQRDYASIAATLAPNVRM
FT                   EQTSALPYAGVYIGPDGMQDWTRRMADYFEVVDVQNPEIFERAGSEKIVVLSNVHFKVR
FT                   KTGKEMDFPFCQAITVDLERGVIVELRPFYWDVAEVNKSLGYAP"
     atgggaacca agaaattcac cgctcgcgaa gtgctagacg ctttctacaa ggcagagcga        60
     gagtacatgc aggctacgcc agagcagcgt gactacgcca gcatcgccgc tactctagct       120
     ccaaatgttc gcatggaaca gacatctgcc ctgccatacg ccggtgtcta cattgggcca       180
     gacggcatgc aagactggac gcgccgcatg gccgattact tcgaggttgt ggacgtgcaa       240
     aacccggaga tctttgagcg cgccgggtcc gaaaagatcg tcgtcttatc gaatgtccac       300
     tttaaggtcc gtaagactgg caaggagatg gatttccctt tctgtcaggc tatcactgtc       360
     gaccttgagc gtggcgtcat cgtcgaattg aggccttttt actgggacgt ggcggaggtg       420
     aataagtctc tgggatatgc gccatga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page