(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE248

PENCW_16.PE248       Location/Qualifiers
FT   CDS_pept        561986..563425
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824377"
FT                   /orf_name="Pc20g02480"
FT                   /product="Pc20g02480 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85577.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183183E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG4"
FT                   /transl_table=1
FT                   /translation="MSLAFNTDSVVPLWLNGAQRVTKTTFDVVSPVSHQALWKASAADE
FT                   GDVEDAIASAATAFETWRWTKPQERREIFLRAYELLKERRDQSMAYSTAETGVPPVMFG
FT                   VEYNGAIDICLQLAGLSAHYGTVVDPDANDTSAVVISQPYGVVLGIGPWNAPHTLGMRA
FT                   CLFPLAAGNTVILKGPEMAPATYWHFVSILHEAGLPAGCLNTIYHRPSDAAAITKQLIS
FT                   HPAIRKVNFTGSTAVGSVIAGLCGQYIKPCLLELGGKASVIVCEDANLELAAEQCALGA
FT                   FSHAGQVCMSTERIIVHDTVADRFRPILKAAIDRIFGEGQPASILINETAAAKVRGLVQ
FT                   DAVTKGANLLYGSLSDGSEGVNRLLPVVVEDVQPGMDIYYNESFGPSVSLYTFTDDEQA
FT                   LKLANDTAYGLTGAVFTEDLRRGLSLAKRLETGAVHINNMTAHDEASLPHGGVKDSGFG
FT                   RFNGPDGLREWVKTKSITWRD"
     atgagcctcg ctttcaacac cgattctgtc gtcccactgt ggctgaacgg agcccagcgc        60
     gtgacaaaga ccacctttga cgtggtctcg cccgtctccc atcaggcctt atggaaagcc       120
     tctgcggctg acgaaggcga tgtcgaagat gcgatcgcat cagccgctac agcctttgag       180
     acgtggcggt ggacaaagcc ccaagagcgg cgcgagatct tcttacgagc ctacgaactc       240
     ctgaaggagc gtcgggatca gagcatggca tacagtaccg cagagactgg ggtgccacct       300
     gtcatgtttg gagtcgaata caacggtgcc atcgatatct gtctgcagct agccggcctg       360
     tccgcgcatt atggcaccgt agtcgaccct gacgcaaatg acactagcgc agtggtcatc       420
     agtcagccgt atggcgtggt gttgggtatt ggaccctgga atgctcccca tacactcggc       480
     atgcgcgcct gtctgttccc tctcgctgct ggaaacacag tcatcctgaa aggtcccgag       540
     atggccccgg caacatactg gcatttcgtt tcgattctgc atgaagccgg tctcccggct       600
     ggctgtttga acaccatcta tcatcgaccg agtgacgccg ccgccatcac aaagcagctc       660
     atatcgcacc cagccattcg aaaggtgaat ttcaccggta gcaccgctgt tgggtcagtt       720
     attgccgggc tttgtggaca gtatatcaag ccttgtctgc ttgagctggg tggaaaagca       780
     agcgtcattg tctgcgaaga tgcaaacctc gaactggccg cagagcaatg cgcgttgggc       840
     gctttcagcc atgcaggtca ggtctgtatg agcactgagc gcatcatcgt tcatgacact       900
     gtggccgacc gcttccgtcc gatcctaaag gcggcgatcg accgtatctt tggtgagggt       960
     cagccggcgt ccattctcat caatgagacg gccgcagcta aagtgcgtgg tctcgtgcag      1020
     gatgcagtta caaagggggc aaatcttttg tatggttctt tatctgatgg gagtgagggg      1080
     gtgaatcgcc ttctacccgt ggtggttgag gatgttcaac ctggtatgga catctactac      1140
     aacgagtcct ttgggccatc tgtgtcgctc tacactttca cggatgatga acaagcactg      1200
     aagctggcga acgataccgc gtatggcctc acgggagcag tgttcacaga ggatctacga      1260
     cgcggactca gccttgccaa acgactcgaa actggggcag tgcatatcaa taatatgacc      1320
     gctcacgacg aggcttcatt gccccatggt ggtgtgaaag acagtggttt tgggcggttc      1380
     aatggacctg acgggctgag ggaatgggtg aagaccaagt cgatcacctg gcgggactga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page