(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE249

PENCW_16.PE249       Location/Qualifiers
FT   CDS_pept        join(complement(565044..565180),complement(564912..564997),
FT                   complement(564673..564764),complement(564603..564624),
FT                   complement(563880..564538))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947804"
FT                   /orf_name="Pc20g02490"
FT                   /product="Pc20g02490 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85578.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183183F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG5"
FT                   /transl_table=1
FT                   /translation="MSLPQKQLCAWVESPGPEAKIEFRDIEVPNPTAGQVLVKLEVSGV
FT                   CHSDHHSIYGNTPMTTHIAGHEGVGIVVADYLRWLHRACRKCATCEMDYTHCPHQDNSG
FT                   RNVPGTFQADADYISRIPAEVPAALAAPLLCGGITMYGALSRAELRAGDFVVIPGAGGG
FT                   LGHLGVQIATSMGFQVIAIDSGDKEDICRDSGARHFFDFRQSGASLVDDVRAAAGGIGA
FT                   HAVICITGAPSAYDSALAMLRNLGRLVCVGIPPAEYRLQLNPFEVLVRGLRVIGSTVGN
FT                   SAQMPLLMDLVLQGKVRPHVQVYTFQELRDVMDKLEHGTVAGRAVLRISD"
     atgtctctcc cacagaaaca gctctgcgcc tgggtcgaat cacccggccc agaagctaag        60
     atcgaatttc gagacattga agttcctaac ccgactgcgg gccaagtgct ggtcaagttg       120
     gaggtgtcag gcgtttgcca ttcggatcat cactcgattt atgggaacac gcccatgaca       180
     acgcatattg ctggccacga aggagttgga attgtcgttg cagactatct cagatggctt       240
     catcgagcat gccgcaagtg tgctacttgt gaaatggact acacacactg tccgcatcag       300
     gataattcag gaagaaatgt gccagggact ttccaagctg acgccgatta tatctcccga       360
     atcccagcag aagtccccgc ggccctcgcc gcacctctgc tctgcggcgg aatcaccatg       420
     tacggtgcgc tctcacgcgc tgagctgcgc gctggcgact ttgtcgtcat ccctggagcc       480
     ggtggtggct taggtcattt aggagtacag attgcgacga gcatgggctt ccaagtgatc       540
     gcaatcgact cgggggacaa ggaagacatc tgtcgggatt ccggggcacg ccactttttc       600
     gattttcgtc aaagcggtgc ctctctcgtc gacgatgtgc gtgctgctgc gggaggcatt       660
     ggggcgcacg ccgtcatctg cattactggt gcgccgtcgg cctacgatag cgctctcgca       720
     atgctgcgca acctgggcag gctcgtctgc gttggtatcc cgccggctga atacagacta       780
     cagctcaacc cctttgaggt actcgtccgt ggcttacggg tgatcggatc gaccgtgggc       840
     aacagcgctc aaatgccgtt gttgatggat cttgtgctgc aaggaaaggt gaggccgcat       900
     gtacaggtct acactttcca ggagctgcgt gatgtgatgg acaagttaga gcacgggacg       960
     gtggcaggga gggcggtttt acgaatctca gactag                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page