(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE250

PENCW_16.PE250       Location/Qualifiers
FT   CDS_pept        join(complement(568164..568259),complement(568007..568110),
FT                   complement(567701..567942),complement(566849..567638),
FT                   complement(566113..566630),complement(565859..566065),
FT                   complement(565592..565788))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977595"
FT                   /orf_name="Pc20g02500"
FT                   /product="Pc20g02500 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85579.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831915"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG6"
FT                   /transl_table=1
FT                   /translation="MLANPAVPATEQQPKRRRVTLACISCRARKSRCSGQRPKCSTCTE
FT                   LGLTCQYVSSGQTDQTVVVGKEHFQTIEERLHHLESLLDQGRASSKRSWSDVDTPDIDN
FT                   QPALTPNLVSTSDGPLTGSIGSDDPTDGMGHFVIAHEEHRAYFGPSSNIAFASELSRTL
FT                   KRLSRSRGEFSPGSKQTTLRDFHIARVSRPSSPMSQSATWAPNNHQQDAATSSIFYLPP
FT                   DQETSVLIDQYFGNTGLLFPYIHEDTFRESYAQLRQNSAGTRRTWLGVLNMVLAMATHT
FT                   TTLPMGKVDKRQAQSEAFYARADGLCSQHVMNGASLEIGQLLVFLSICPGHELFDAIVR
FT                   DIDRKTVQYLLLVSQYMQGTRSSIQTWATHGLAVKVALQLGLHSVEASRRFSPVEREVR
FT                   KRTWFGCIVLDRYPVKETRIGRSDCQGNSQDCSRLYSIMGNAIDLLYDGNLGSEDKILN
FT                   YELITRVLRMRHSLEEWIEQLPAHMRLIRAENCAAELGKDPTNDRFRTILTLRYHNLQV
FT                   LIHRAVLLRLCDYQDQNILALQDIAWSTEQITIESATEIINIVRFVVEAGLVQQGLLGA
FT                   WWFTLYYMFDAALILFTILLVKRFSSIKLYPPTTLDSIKEVFLSCIEPLRRLDEGNRTV
FT                   DKCCRCLQALSEVWNSIEINNEESLAQDIPLLTQPRDYNYHHDNSVVGQEFADQSLSFL
FT                   DFDLMANELFDVTDGLVPGWGVQ"
     atgcttgcga accctgcagt tcctgccact gagcagcaac caaagcgacg ccgggtcacc        60
     ctggcttgca tttcctgccg cgcccgaaaa tcccgctgca gcggccaacg acccaagtgc       120
     agcacgtgta ccgagttagg gctgacctgc caatacgtct cgtcaggaca gactgatcag       180
     actgtagtgg taggcaaaga acactttcaa accatcgaag aacgcttgca tcacctcgag       240
     tcgctgctag atcaaggccg cgccagctcc aaaagatcat ggagtgacgt ggacacgccc       300
     gacattgata atcagcctgc actgacaccc aaccttgtct ccaccagcga tggcccgctg       360
     actggatcaa tcgggtcgga cgatcctact gatggcatgg gccattttgt gattgcccat       420
     gaggaacatc gcgcttactt tggaccgtca tcgaatatcg cgtttgcgtc ggagttgtcg       480
     cgcaccctga aacgcctatc acgcagccgc ggcgagttct cgcctggcag caagcagacg       540
     acgctgcgag actttcacat cgcgcgagtt tcacgaccga gctcgccaat gtctcagtca       600
     gcaacatggg ccccaaataa ccaccagcaa gatgccgcca cgtcgtcgat tttctatctg       660
     ccgccggacc aggagacttc ggtactgatc gaccagtatt ttggtaatac cgggttactc       720
     ttcccatata tccacgaaga cactttccgt gagtcatatg cccagctgag gcagaactcc       780
     gcgggcacac gtcgcacttg gctgggagtt ctcaacatgg tgctcgccat ggctactcac       840
     acgacgacac tgccaatggg caaggttgat aaacgtcaag cccagtccga ggcattctat       900
     gcccgtgcag atgggctttg ttctcagcac gtgatgaatg gagcaagctt ggaaattggt       960
     cagttacttg ttttcctttc gatttgtcct ggacatgaat tgttcgatgc catcgttcgt      1020
     gatattgacc gtaaaacagt tcagtatcta cttctagtaa gtcagtatat gcaagggacg      1080
     agatcatcca tccaaacatg ggcaacgcac ggactcgcag taaaagtggc tttgcagctc      1140
     ggactgcact cagtggaggc ttcccggcga ttctcccccg tcgagcgtga ggttcggaaa      1200
     cggacgtggt tcggctgtat tgttcttgat agatacccag tgaaagagac caggatcggg      1260
     agaagtgatt gccagggaaa ctcacaagat tgcagtcggc tctattctat catgggcaac      1320
     gccatcgatc tcctttacga cggcaatttg ggaagcgagg acaaaatcct caactatgag      1380
     ctgatcacgc gcgtcctgcg catgcggcat tcgctagagg aatggatcga acagctgccc      1440
     gcgcacatgc ggctaatacg agcggagaac tgcgccgcag agctggggaa agatccaact      1500
     aatgaccgat tccgcacgat cctcaccctc cgatatcata atcttcaagt gctaattcat      1560
     cgcgccgtcc ttcttcgtct gtgcgactac caggaccaga atattctagc cctgcaggac      1620
     atagcctgga gtacagagca gataaccatc gaatcagcga ctgagatcat taatatcgtc      1680
     cgcttcgtcg tcgaggcggg actggtgcag cagggcttgt tgggtgcatg gtggtttacg      1740
     ctatattaca tgttcgatgc tgccttgata ttgttcacaa tcttgctcgt gaaacgattc      1800
     tcttccatta agctctatcc gccgactacc cttgactcca ttaaggaggt attcttgagc      1860
     tgtatcgagc cgctccggcg gcttgacgag ggaaatcgca cggttgataa gtgttgtcgg      1920
     tgtctacagg cattgtcgga agtgtggaat tcgatcgaaa taaacaacga agaatctctt      1980
     gcccaggata tccccctgct gacccaacca agggattata actatcatca tgataattcc      2040
     gttgtaggtc aagagtttgc ggatcagagt ctctcgtttc tcgactttga cttgatggct      2100
     aatgagttgt ttgatgtcac tgatggcttg gtgccagggt ggggagttca ataa            2154
//

If you have problems or comments...

PBIL Back to PBIL home page