(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE251

PENCW_16.PE251       Location/Qualifiers
FT   CDS_pept        join(complement(569891..570179),complement(569404..569838),
FT                   complement(569035..569339))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824378"
FT                   /orf_name="Pc20g02510"
FT                   /product="Pc20g02510 protein"
FT                   /protein_id="CAP85580.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001831916"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG7"
FT                   /transl_table=1
FT                   /translation="MATETETVSKVEASKNVEASDQEIDTSDGLALALEKLETKPLWTQ
FT                   MTKLNPPLLNPSCVPHVWRYDQIRPSLLKAGELVNESQAERRVLMLVNPARDAPYTTDT
FT                   LYAGLQLVMPNETAQAHRHTAFAMRFIIEGQGGFTAVHGQRISMQRGDVILTPRWNWHD
FT                   HGKDGTGPMIWLDGLDLPNFRHFPVHFVEHYQHARYPADDVDSNTSPIVFPWVKMKQAL
FT                   DDTPGDWASKDYLKSDGRPVSKVLGGSAERLRAGQSSPEIRETASSVYHVVSGRGYSTI
FT                   GDSRITWGPGDTFCIPSWHRYEHFADTEEDVYLYRFHDKPMLDALGFYRVEGVDVESLV
FT                   SD"
     atggccactg aaacagagac cgtgtccaag gttgaagcct cgaagaatgt ggaggccagc        60
     gaccaggaga tagatacatc cgatggtttg gctctggcgt tggagaagct cgagaccaag       120
     ccactctgga cacagatgac gaagctcaac ccgcctctcc tgaaccccag ctgtgtacca       180
     cacgtctggc gctatgacca gatccgaccc agtctgttga aagccggcga actggttaat       240
     gagagccagg cagaacggag agtgttgatg ttggtgaacc cagctcgaga cgctccctac       300
     acaaccgaca cactatacgc aggcctgcaa ctagtgatgc ccaatgagac tgcacaggcg       360
     catcgacaca cggcatttgc catgcgattc atcatcgagg gccagggcgg ctttaccgcg       420
     gtgcacgggc agcgcatcag tatgcagcgt ggtgatgtga ttttgactcc gcggtggaac       480
     tggcatgacc acggaaagga tggcacaggt cctatgatct ggctggatgg actcgacctg       540
     cctaacttcc ggcatttccc cgtccacttt gtcgagcatt atcagcacgc tcggtatccg       600
     gctgatgatg tagactccaa cacgtcgccc attgtgttcc cctgggtgaa gatgaagcag       660
     gcccttgacg acaccccggg tgattgggcg tcgaaggact acttgaagag tgatggccga       720
     ccagtctcca aagtcctggg agggtcagct gagcgactca gagctgggca gagttcacca       780
     gaaatccgag aaacagcctc ttcggtctac catgttgtgt ctggcagggg ttattccacc       840
     atcggggata gtcgcattac gtggggacct ggagacacct tctgtattcc ctcttggcac       900
     cgatacgaac attttgcgga tactgaagag gatgtctacc tgtaccgctt ccatgacaag       960
     ccaatgctgg acgctcttgg attctaccgc gtggagggtg ttgatgtcga atctttggtg      1020
     tctgattag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page