(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE255

PENCW_16.PE255       Location/Qualifiers
FT   CDS_pept        join(complement(576444..576581),complement(576196..576420))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128707"
FT                   /orf_name="Pc20g02550"
FT                   /product="Putative uncharacterized protein Pc20g02550 "
FT                   /protein_id="CAP85584.1"
FT                   /db_xref="UniParc:UPI000183191A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH1"
FT                   /transl_table=1
FT                   /translation="MRMNFSGHSVILYFERLPKGWMGLSSDIGAHKITQQRALSAAHVE
FT                   QAISYHGDEEGRKMRYGPMERRLCMKPPRMANATNWANAQCAQRKTHTLHASHVCMRVN
FT                   NTEVKWRCGGRLKERK"
     atgagaatga acttctcggg ccattcggtg atcctatact tcgaaaggtt accaaagggt        60
     tggatgggct tgagtagtga tattggtgcc cacaagatca ctcagcaacg agctctcagc       120
     gctgcccatg ttgaacaggc catatcctac cacggggatg aagaaggaag aaagatgcga       180
     tatggaccta tggaaaggag gctgtgtatg aagcctccaa gaatggcaaa tgcgacaaac       240
     tgggcaaatg ctcagtgtgc acagagaaaa acgcataccc tgcacgcatc tcacgtatgt       300
     atgcgtgtca acaatactga agtgaagtgg aggtgtggag gaaggttgaa agaaagaaag       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page