(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE256

PENCW_16.PE256       Location/Qualifiers
FT   CDS_pept        join(578349..578957,579028..579970,580029..580096)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947806"
FT                   /orf_name="Pc20g02560"
FT                   /product="Pc20g02560 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85585.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI000183191B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH2"
FT                   /transl_table=1
FT                   /translation="MKINHSSFLLFLLPAISAVLADTTYNDNIDSRVSRETAGNNARLV
FT                   DSDIVASNVAKGAPDVPVDGKDGRPHAGPWVETNADRDRKGVKGTDDIDSVSTKYDTKI
FT                   PSSEHLSTEEGKMIPHSNGGVMDDPHRAGPKEGTRGTEGGVSEKGKEGKLTSEKAPGGP
FT                   KEAPPLPHSETKKLGSDSDDTTTGTGSRSAESQGSLGMLGKPADLPEKPHDIPYPKPPA
FT                   MVKDDPLGLGHDSVASGSPSSSSSSSLTHDYDYDHDSGIPDAGSSLHSLVFSFTMILVS
FT                   EIGDKTFLVAALMAMRHPRLVVFSAAFSALILMTVLSAVLGHAVPTLIPKTFTKFMAAI
FT                   LFLIFGVKMLKEGREMSPDEGVGEEMREVEAELEEKEHEQLRMDRRRSSVTPHNLEAGR
FT                   AGGRPKTRGSGNRLPSPPESLSSSSSRGSSPQPRQRLDSIFSGLSNLFSLLLSPAWVQT
FT                   FVMTFLGEWGDRSQIATIAMAAGQDYWWVTIGASAGHGICTAAAVIGGRAIAGRVSMRV
FT                   VTLGGAVAFLVFGVIYFIEAIF"
     atgaagatca atcactcgtc cttccttctt ttccttcttc ccgccatttc ggccgtgctc        60
     gccgacacaa catacaatga caacatagac tcccgagtct cgcgtgagac tgctggaaac       120
     aacgctcgtc tcgtcgattc ggatatagtc gcatccaatg tcgccaaagg ggcgccggac       180
     gttcccgtgg atggcaaaga tggcagaccg cacgcaggcc cgtgggtgga aaccaatgca       240
     gaccgggacc gcaaaggtgt caagggaact gatgacattg actctgtttc tactaaatat       300
     gacaccaaga ttccctcttc ggaacacctg agcaccgaag aagggaaaat gatcccgcat       360
     tcaaacggcg gcgtcatgga tgatccgcat cgggcgggcc cgaaagaagg aacacgagga       420
     acggaaggtg gtgtgtctga gaaaggcaag gagggcaaat tgacttccga aaaagccccc       480
     ggagggccga aagaagcgcc tccgctaccg catagtgaga ctaaaaagct gggctctgac       540
     agcgacgata caacaactgg gactggaagc cggtctgcgg agagtcaggg aagtcttggt       600
     atgctgggga aacccgccga cctacctgaa aagccacacg atattccata ccccaagccc       660
     ccggccatgg tcaaggatga tcctctgggt cttgggcacg actcagtcgc ctcagggtcg       720
     ccttcgagtt catcctcgtc ctcattgacc catgactatg actatgacca tgactccggt       780
     atccccgatg ccggcagctc actacactcc cttgtatttt ccttcaccat gattctcgtt       840
     tctgaaatcg gcgacaagac tttccttgtg gctgcgctga tggcaatgag acatccccgc       900
     ttggtagtgt ttagcgccgc atttagcgcc ttgattttga tgactgttct ttcggccgtc       960
     ctgggccatg cagttcctac ccttattcca aaaactttta ccaaatttat ggctgctatt      1020
     ttgttcttga tcttcggtgt gaagatgctc aaagaaggtc gtgaaatgtc tccagatgag      1080
     ggtgtgggcg aagagatgcg agaggtcgag gcggagctcg aagagaagga gcacgagcag      1140
     ctgcgcatgg accggcgtcg ctcctcggtt actcctcaca acctcgaagc aggtcgcgct      1200
     ggaggccgcc ccaaaacccg cggctccgga aaccgcctac cttcgcctcc ggagagcttg      1260
     tcctcgtcct cgtcccgtgg ctcttccccc caaccccgtc agcgcttgga tagtatcttc      1320
     tccggattga gcaacctctt ctccctgctt ctcagccccg cctgggtcca gacctttgtc      1380
     atgaccttcc tcggcgaatg gggagaccgc agccaaattg cgactatcgc catggcagct      1440
     ggccaagact actggtgggt gacgattgga gctagtgctg gtcacgggat ctgcaccgca      1500
     gccgccgtga tcggtggacg agctatcgct ggtcgggtca gcatgcgtgt tgtgactctg      1560
     ggcggtgctg tggcgttcct tgtgtttggc gtcatctact tcattgaagc catcttttaa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page