(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE257

PENCW_16.PE257       Location/Qualifiers
FT   CDS_pept        join(580904..581000,581196..582564,582617..583673)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947807"
FT                   /orf_name="Pc20g02570"
FT                   /product="Pc20g02570 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP85586.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000183191C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH3"
FT                   /transl_table=1
FT                   /translation="MARLMGSRMMRSRSREAANPGFMPNKGSLERNWLTGVTEEPSTPS
FT                   PGFIAPRHVVPESPENHEGHTNVSGTTLGHNDVEPVGSQVADKIATHLPFVQQQATLVM
FT                   SLLVRPELNPDSLAAESKRLLDSNHPNRKRLRRSVEGLTDELEDSPLSRDGRSFLDISQ
FT                   ARRLLSPAQLDASIAYIYMTNCALLTLNMFLPSMGIESQSEVMQQLDSQFPGCVMSNLV
FT                   ESSMTRDIGASNTTETTFNLALGIRTQFFIMELERRQHEQDFNPLSILRQIFAMDLAPS
FT                   EDDSPASFRGFNLPGVLQDEDGHLPEYLPERFLIAISDRFNELHEEISEWDSLDIDGLR
FT                   KAYRWRSFERDLARWVYARDREIKDDIRRLSERLRISPSPRRLTSVPAGTPNRRPGSTV
FT                   PPSGDISRPRPLPQQTHSPQKERLVNAPGANRAPQAETVVQAEQSAQAGNIPGDIASRS
FT                   GITSQTVPEQSVSNQVAQTVSKDPGRRKSKSNYRDPASLAALMRRQATSRPQPASNVAS
FT                   QAQNISTGTNIVTQADPSANRGVDSVEIQQSPDMTYRDIGDESTYVNNDEDLDLGQGPE
FT                   PDVMTSTSPPTSSRIGRVSHNPNPRFFDSPRDGNTQRSVPAARRFLDKQSNARVVSPIS
FT                   QYDAPSPGNQFTVLGKRNRNADPPDDDLSDESDVEFEQNNQDLDPRRRVEKPQQKLPAA
FT                   KRQRPEDNAGSVGERLPSSINQSFRHNQPISTQGAQRVQRAESDDITDDETAVEQYEAP
FT                   TRTQGPWAASNSQAALVNRRVRGATHRWTEEEDERLIYLLGIYGTSYSAIKKQDNACPP
FT                   SEGGPMLERRSQVNCKDRARNLKKKYLR"
     atggcccgcc taatggggtc ccgcatgatg cgaagtcgga gccgagaagc agcgaatcca        60
     gggtttatgc caaataaagg atcattggag cgaaattggc tgactggggt gactgaggag       120
     ccttctactc cttctcccgg ttttattgca cccaggcatg tggtaccaga gtcgccagaa       180
     aaccatgaag gtcataccaa tgtctctggt acgaccctgg gtcacaacga tgttgagccc       240
     gtcggctctc aagtcgccga taaaattgcg acccacctgc cgttcgttca gcaacaggcg       300
     acgcttgtta tgagtctctt agttcgaccg gagttgaacc ctgatagcct tgcagctgaa       360
     tcgaaaaggc tccttgattc taatcacccg aatcgtaaac gcctgagacg gtccgtggaa       420
     ggactaaccg atgaactgga ggactccccc ctttctcgtg atggcaggtc atttttggac       480
     atctctcaag ctcgtcgttt gctttctccc gcgcaattgg atgcgtccat tgcatatatt       540
     tacatgacga actgcgctct gttgactctc aacatgttcc tccccagcat gggtatcgag       600
     tcccagtcgg aggtcatgca acagctggat tcccagttcc cgggatgtgt tatgagcaac       660
     cttgtagaaa gttctatgac aagggacatt ggagccagta ataccaccga gaccaccttc       720
     aaccttgcct tgggtatccg cacgcagttc tttatcatgg aattagaaag acgccaacat       780
     gagcaggact tcaatccact ctctatcttg aggcagatct tcgctatgga ccttgcaccc       840
     agcgaagacg actcccctgc ttctttccga gggttcaact tgccaggtgt cttacaggac       900
     gaggatggcc atcttccaga atacctacct gaaaggtttc tcatcgccat cagcgacagg       960
     ttcaatgagc ttcacgagga aatttctgag tgggatagcc ttgatattga tggtctgagg      1020
     aaggcataca gatggcgatc gtttgaacgg gaccttgcac gttgggtata tgctcgtgac      1080
     agagaaatca aggacgacat cagacggttg tcagaaagat tgcgtatctc acccagccct      1140
     cgtcgcctta cttctgtccc agctggaact cccaatcggc gtccaggatc gacagtgcct      1200
     ccaagtggtg acatttctcg tccgagaccc ttgccccaac agactcattc tcctcagaaa      1260
     gaacgattgg tgaacgcgcc aggtgcaaat agggcgcccc aggcggagac ggtagtgcag      1320
     gcagaacagt cagcccaggc gggcaacata cccggagaca tcgcttctcg gtcaggcatc      1380
     acttctcaaa cggttcctga acaaagtgta tccaaccaag tcgcacagac tgtatcaaaa      1440
     gatcccggtc ggcgcaagtc caagagcaac taccgagatc cggcgtcgct cgcggcactc      1500
     atgaggcgtc aggctactag tcgtccgcaa cctgcctcaa acgtcgcttc gcaagcgcaa      1560
     aatatttcta ctggcacgaa cattgtcact caagccgatc cttctgctaa tcgcggagtc      1620
     gattccgttg aaatccaaca atcccctgat atgacatacc gagatatcgg ggacgagtcc      1680
     acgtatgtaa acaacgacga ggacttggac ctcggtcagg gtccagaacc tgatgttatg      1740
     acatcgacca gcccccctac ctcctctaga atcggtcgcg tcagccacaa tcctaatcct      1800
     cggttctttg attcacccag agacggaaac acacagcgat cagttccggc cgctcggcgc      1860
     ttcctcgata agcagagtaa cgccagagtt gtgtcaccga tcagccagta cgatgctcca      1920
     agtccaggga atcagttcac tgtcctgggg aaacggaatc gaaatgctga tcccccggat      1980
     gatgacttga gtgatgagtc agacgtcgaa tttgagcaga acaatcagga cctcgacccc      2040
     aggcgcaggg tcgaaaagcc ccagcagaag ttgcctgccg cgaagcgaca gcgcccggag      2100
     gacaacgcag ggtctgtcgg agaacggctg ccatcgagca tcaaccaatc gttccgccac      2160
     aaccagccta tctcaacaca aggcgctcaa agagtgcaga gagccgaaag tgacgatatc      2220
     accgatgatg aaaccgctgt tgaacaatac gaagcgccca ctaggaccca gggtccctgg      2280
     gcagcctcca actcccaggc tgcgcttgtc aatcggagag ttcgaggggc gacccacaga      2340
     tggacagagg aagaagatga acgtctgatc tacctcttgg ggatttatgg cacttcctat      2400
     tccgccataa agaagcaaga caacgcttgt cccccgtctg aaggcggccc catgcttgag      2460
     cgtcgctctc aggttaattg taaagatcgt gctcgcaatt tgaagaaaaa gtatctcagg      2520
     tga                                                                    2523
//

If you have problems or comments...

PBIL Back to PBIL home page