(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE258

PENCW_16.PE258       Location/Qualifiers
FT   CDS_pept        join(584958..585211,585247..585420,585472..585535,
FT                   585699..586937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671682"
FT                   /orf_name="Pc20g02580"
FT                   /product="Pc20g02580 protein"
FT                   /protein_id="CAP85587.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000183191D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH4"
FT                   /transl_table=1
FT                   /translation="MGNGKGKNKGKGRGKKRSRSLKENKVAAKVEIKPEDKIEDKIEIK
FT                   GKHHCLRKRPTHAPTSRCLRLGHVVQCPIHPNSFPRRLSDATGAQGQKEVEQQLISFFW
FT                   SFKVDRACQRTLLDICLLLLWLCYVGLYILASYYSTEERFIFLSIPDFGEKLHIEQYKG
FT                   YRRHSVCAHNNHPMWKNTKPRHLAFRAHHRHVITCLQFDADKIIVGSDNTHINVYDTKT
FT                   GALRAKLEGHEGGVWALEYHDNTLVSASTDRTIRVWDIAKAKCTHVFQGHTSTVRCMKI
FT                   LLPVQIDQHERPQIISGSRDSTMRIWKLPQPGDSEYFPPTESVEECPYLIRVLTGHQHS
FT                   VRAIAAYGDTVVSGSYDCTVRVWKISTGESLHCLQGHTFKVYNVCLDHERNRCISGSMD
FT                   STVKIWSLDTGALLYNLEGHSSLVGLLDLKEDLLVSASADSTLRVWNPANGHCQSTLGS
FT                   HTGAITCFQHDGQKIISGSDASLKMWDTRTGVFERDLLTDLSGTWQVQFDTQHCVAAAQ
FT                   RGDVSYIEVSTHPTDIPSIYNLLFMKILDFGASPETIPSGQFGKRVLVDELGNEIESPK
FT                   "
     atgggcaacg gcaagggaaa gaacaagggt aagggtaggg gtaagaaaag aagtcgcagt        60
     ctgaaggaga acaaggtcgc agcgaaggtc gagatcaagc ccgaagacaa gatcgaggac       120
     aagatcgaga tcaagggcaa gcatcactgt cttcgaaagc gacctactca tgcacccact       180
     tcgcgatgcc tccgtttagg ccatgtggtc caatgtccga ttcatcctaa cagcttcccc       240
     cgacgattga gcgatgcaac aggagcgcaa ggacagaaag aagtagagca acagctgatt       300
     tccttctttt ggtctttcaa ggtagatagg gcatgtcagc gaactcttct tgatatatgt       360
     ttgttattac tatggttatg ttatgttgga ctatatatac ttgccagtta ctacagcact       420
     gaggagaggt tcatcttcct ctctataccc gattttgggg agaaactcca tatagaacag       480
     tacaagggct accgaaggca ttcagtgtgc gctcataaca accacccgat gtggaaaaat       540
     acaaaaccta ggcatcttgc cttccgagca caccatcgac atgttataac ctgtttgcaa       600
     ttcgacgccg acaaaattat agtcggtagc gacaataccc acatcaatgt gtatgacacc       660
     aagacaggag cgcttcgagc aaaactggaa ggccacgaag gtggtgtatg ggcacttgaa       720
     taccatgaca atactctggt ctctgcatcg accgaccgta ctatccgagt atgggacatt       780
     gcgaaagcca agtgcaccca cgtgttccaa ggtcacacat ccacagtacg gtgcatgaag       840
     atattgctcc cagttcaaat tgaccagcac gaacgacctc aaatcatttc aggttcccgt       900
     gattcgacca tgcggatctg gaaacttcct caaccaggcg actcggaata tttccctccc       960
     actgaaagcg tcgaggaatg tccatatctc atccgtgtat tgaccggtca ccaacattct      1020
     gtgcgagcaa tcgcagccta cggggacacc gtagtcagcg gcagctacga ttgtactgta      1080
     cgagtttgga aaatatccac cggagaatca ctacactgtt tacaaggcca tacattcaag      1140
     gtttataacg tatgtctgga ccatgagagg aatcgctgta tcagtggatc gatggacagc      1200
     acggtcaaga tctggtctct tgatacaggt gcgttgttat ataatcttga aggccactca      1260
     tcgttagtgg gcctccttga tttaaaagaa gatctgctcg tgtcggcctc tgcagactct      1320
     acactccgtg tctggaaccc agcgaatggc cattgtcaaa gcacgctggg tagtcatact      1380
     ggagcgatta cctgctttca gcacgatggt caaaagataa tctctggttc tgatgcgagc      1440
     ttgaagatgt gggacacacg gactggtgta ttcgaaaggg accttctcac cgacctcagc      1500
     ggcacctggc aagtccagtt cgacacccag cattgcgttg cagcagctca gcgtggagac      1560
     gtgagttata tcgaggttag tacgcacccg actgatatcc cgtccattta taatttatta      1620
     ttcatgaaga ttctcgactt cggtgcatcc cctgaaacca taccatctgg ccagttcgga      1680
     aagcgggttt tagttgatga actcggtaat gagatcgaaa gcccgaagtg a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page