(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE259

PENCW_16.PE259       Location/Qualifiers
FT   CDS_pept        588003..591038
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128708"
FT                   /orf_name="Pc20g02590"
FT                   /product="Pc20g02590 protein"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /protein_id="CAP85588.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000183191E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH5"
FT                   /transl_table=1
FT                   /translation="MEQLLCNRANEASNALAVIDGDHRFTYRDLLAKADILAADLLKKG
FT                   LGTEEPVGIVVGPGWQQIIARVAVLRAGGTSVPIDPSAPDIQLHAMLGDLSTRFVMTTN
FT                   NLAGKVSQFNILPIETVLDPEYQTEKHGEINAMSGKSEGHRSHILHTSGSTGKPKAVQI
FT                   SSKAVLHLAASLPVDIGEGDKVGQLNNPGFDLSLFEVWVTLLSGGTVVHIPKSIIKDPV
FT                   SFAAFLKDTGLTALILPCALFTAVSASTPSAFQSVRHVVSAGESPSPQAMQKVLSSDGP
FT                   PENLWNGYGPTETTCLSTLQRVTLEEAECGPISAGVPFGDTVLHLLDEAQKPIVDDEIP
FT                   GEICIGGPGLSAGYLNHTEANAEKFIRIEVADSQDPRRVKITRLYRTGDIGMWKGLPKR
FT                   LQYIGRVDLQVKHQGFRVELEAIEQTIAANDSIRAVACLHQKAGDGPGLDRLIAVVAPA
FT                   NDMPLDPQKIIEWTQNRHPYYMVPNQVRVVSEIPLNSRGKVDRDALHKEIKESRPLKST
FT                   QDNAKDESSLAKVTKILEENLGLSNIGPDDNIISLGLSSLQVARFLGLIKQKIGKLISI
FT                   KDLYINPSIRSLVHHLHQADETNYGPSEVLQFEADAHLADDIELIPDWTSEGRVFLTGA
FT                   TGFIGVNLLYRWLSRPSMKEVEIACLARGNENYSPMDRIKNALKKYDLWSEDISQEMKR
FT                   VIVLDGDMTQERLGLPHSDYQWLINWAPAVFHAAAKVNWCDSYNGHFAQNVQGTKNVLR
FT                   VAAEGRRKTMHYISSIDVWAVTGLILGTDVVSEDGPLKVHLASLPFDTGYAQSQWVADE
FT                   MVQRVRDKGLPVTIYRPGFVVGDSKTGAGNPDDFFGRLIAGCIQLGYWPHMPHQNQEYV
FT                   TVDYVCDSIIRIASDNRNIGHAYTLSSPNPGQITNMERLCVLINQAGFSVQEIPYAEWL
FT                   EKMQAWDGFESSPCLPLMPLLAEPILRGDTRLQTSKYSPRYDCANTLKAIGACDDIRFV
FT                   QLTPDLVKKYIDFWARKGFYNF"
     atggaacagc tgctttgcaa tcgagccaat gaagccagca acgctctggc tgttatcgat        60
     ggagatcatc gtttcacata tcgtgatctt ctagccaaag ccgacattct ggcggcggac       120
     ctgctcaaga aaggcctggg tacggaagag cctgtcggta tcgttgttgg accaggttgg       180
     cagcagatta ttgctcgggt tgcagtcttg agagcagggg gaacctctgt gccaattgat       240
     ccctctgccc ctgatataca actccatgcc atgcttggtg atttaagcac ccgattcgtg       300
     atgacaacga acaatttagc gggcaaagtc tctcaattca atatcctgcc catcgaaacg       360
     gttttggacc ctgaatacca gacagagaaa cacggtgaaa tcaatgcgat gtctgggaaa       420
     tcagaaggtc acagaagtca tattcttcat acatctggtt cgactggaaa gcccaaggct       480
     gttcaaattt cttcgaaggc tgtgcttcac ctcgccgcat cactccccgt agatattggg       540
     gaaggtgata aagtcgggca gctgaacaac ccgggatttg acctttcttt gttcgaagtc       600
     tgggttacac tgctttccgg tggtacagtg gtgcacatcc caaagtccat tatcaaggat       660
     ccagtctctt tcgccgcctt tttgaaagat acgggcctta cggcgctcat tctaccctgc       720
     gccctcttta ctgcggtatc tgccagcacc ccttctgctt tccaatccgt tcgtcatgtt       780
     gtgagtgcag gagagtcgcc cagtcctcag gcaatgcaaa aggttctcag cagtgatggc       840
     cctcctgaaa acctgtggaa cggctacgga cctacagaga caacatgtct ctccactctg       900
     caacgagtga cacttgagga ggctgagtgt ggacccatta gtgccggagt accatttgga       960
     gataccgtgc tccacctcct tgatgaagcc cagaagccaa ttgtcgacga cgaaattcct      1020
     ggtgaaatat gtattggagg gccaggctta tccgcagggt acctgaacca caccgaagca      1080
     aatgccgaga agttcattag gattgaggtt gcggactctc aggaccctag acgggtgaag      1140
     ataactcggc tgtatcggac cggtgacatt gggatgtgga aggggctacc aaaacgcctc      1200
     cagtacattg ggcgcgtaga cctccaggta aaacaccaag gtttccgtgt tgagctagag      1260
     gcaattgagc agactatcgc agcaaatgat agcattcggg cagtggcctg cttgcaccag      1320
     aaagccggtg atggtcctgg attagaccgt ctgatagcag ttgttgcccc agcaaacgat      1380
     atgccacttg acccccaaaa gatcatcgaa tggacacaaa accgccatcc ctattatatg      1440
     gtccccaatc aagtcagggt tgtctctgag attcctctga attctcgcgg caaagttgac      1500
     cgtgacgctt tgcacaagga gatcaaggaa tctcggccct tgaaatcaac tcaggataac      1560
     gcgaaagatg agagctccct tgcaaaggtt accaagatct tagaagagaa cctaggactc      1620
     tcgaatatcg gtcctgacga caacattatt tctctcggcc tatcatcttt gcaagtcgct      1680
     cgattccttg gtctgataaa acaaaagatt ggaaaattga tatcaatcaa ggatctatat      1740
     atcaatccga gcattagatc attggtacat cacctacatc aagccgacga gacaaattat      1800
     ggaccgtccg aagtcctaca attcgaagct gacgcccatc ttgctgatga cattgagttg      1860
     atcccggact ggacatctga aggtcgcgta ttccttacag gtgcgaccgg atttatcgga      1920
     gttaacttgt tgtatcgttg gctctccagg ccatctatga aggaggttga gatagcatgt      1980
     ctcgctcggg gcaacgaaaa ttactcgcct atggaccgga tcaagaatgc tctcaagaaa      2040
     tatgacctct ggagcgaaga catttcccag gaaatgaaga gagtgattgt cctggacggt      2100
     gatatgacac aggaacgcct tggccttccg cacagtgact atcagtggct cattaattgg      2160
     gcaccagcgg ttttccatgc ggctgcgaag gtcaactggt gtgattccta caacggccat      2220
     ttcgcgcaaa atgtccaggg taccaagaat gttcttcgcg tcgcagcaga aggccggcga      2280
     aagaccatgc attacatctc cagtatcgac gtttgggcag tcactggcct tatactcggg      2340
     acagacgtcg tgtctgagga tggtccgctc aaggtccatc tcgcttcgct cccattcgat      2400
     accggctatg cccaaagcca gtgggtagca gacgagatgg ttcaaagagt gcgcgacaaa      2460
     ggcctcccag tgaccattta ccgccccggg ttcgtcgtcg gtgacagtaa aacaggcgca      2520
     ggaaacccag acgatttctt cggtcggttg atcgccggat gcatccaact gggatactgg      2580
     ccacatatgc cacaccagaa tcaggaatat gtcacagtcg actacgtctg cgattcgatt      2640
     attcgtatcg cttcagacaa ccgcaatatt ggccatgcct ataccctgag ttcgccaaac      2700
     ccaggtcaaa ttacgaatat ggaaaggtta tgcgtactta taaaccaggc tggcttttcg      2760
     gttcaagaaa ttccgtatgc agaatggttg gagaaaatgc aagcgtggga cgggtttgaa      2820
     tcgagcccct gtttaccttt gatgcctttg cttgcggagc ccatcctacg tggtgataca      2880
     cgtcttcaaa caagcaagta ttcgccgagg tacgactgtg cgaatactct caaggcaatt      2940
     ggcgcttgcg acgatattcg ctttgtccaa ctcacacccg acctcgtcaa gaagtatatc      3000
     gacttctggg ctcgcaaagg tttctacaac ttttga                                3036
//

If you have problems or comments...

PBIL Back to PBIL home page