(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE260

PENCW_16.PE260       Location/Qualifiers
FT   CDS_pept        join(complement(591837..591941),complement(591529..591768))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824379"
FT                   /orf_name="Pc20g02600"
FT                   /product="Putative uncharacterized protein Pc20g02600 "
FT                   /protein_id="CAP85589.1"
FT                   /db_xref="UniParc:UPI000183191F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH6"
FT                   /transl_table=1
FT                   /translation="MPRLGLRGFAVVLAVIIMSLLGALFGNTGWVYYIVVGIPGIWSLA
FT                   NLALIVFKRPVHPGAHIALDFIFTIVQLFFGIISLLAEQVSSLYGSSLHSSHSSWSMAV
FT                   AAFALMVING"
     atgcctaggc tgggcctgcg tggctttgcc gtggttctgg ctgttattat aatgtcactc        60
     ttgggagcct tattcggcaa cacgggctgg gtatactaca ttgtcgtcgg catcccagga       120
     atctggtccc tggccaacct cgccctaatc gtcttcaagc ggccggtcca ccccggtgcc       180
     catattgctc tggatttcat tttcacgatt gttcagttgt tttttgggat catcagcctt       240
     ctcgccgagc aagtgtcctc tctttacggc tcatcactgc actcctcgca ctcctcatgg       300
     agcatggccg tcgctgcctt cgcactcatg gttattaatg ggtaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page