(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE261

PENCW_16.PE261       Location/Qualifiers
FT   CDS_pept        join(593413..593908,593965..595539,595632..595708)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947808"
FT                   /orf_name="Pc20g02610"
FT                   /product="Pc20g02610 protein"
FT                   /protein_id="CAP85590.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI0001831920"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH7"
FT                   /transl_table=1
FT                   /translation="MGNPEHDFSSKHTEAVSNTEAVSNHPPYSSITESIDEPPTYGQSN
FT                   ASYRVSHDGFPRSVVVVVDECITHLKLLSAIAKLRNFIKGTDKLFGIHDAEIRNFSNNQ
FT                   QAQAAARIREKRWAVYVARAVDRFTIWWQSYLPSLKTSHISTLNTASEANIAWSANMMP
FT                   PLDVIMVWHAFMLNPRAFLEDCLRQSKMSVWATGMPWDIINASIDDKTLVFYPDRDSEA
FT                   RINFEAITGHSWENIHDSPAKSLPCIGCKQEIIAPWTEGSIGCDTDVAFAHCTGYADKS
FT                   LRVSCPACKFNTTHDTLRVQKFRSDVQKLLKDDIPMPGTLLSQNGTPADDGNGDNVSFP
FT                   NRLIKEGIRSELLQLTDLTENESTTIETIRDHLEAYLKSRSVMRRVNKTILASGNSSMP
FT                   ERISLRNMLSRYWDNSSPFAIDLVGAVIRQGTFVDKMDNIGWVRSPNPRSTMGHFIGKY
FT                   GVFFQIMVKNKGHAVVPTLDVDLIWHTHQLSPIRYYIFSTTQMEGIFINHDDKIDETKL
FT                   NDAFAWTSRQYQKLTGGKIYSECTCWYCEAVRESNNQGLGRLISPSTLHAKTNAALLHN
FT                   SADNATDGKSKEPHISSHNAVRILAQADPKAMQTKTAQLESCWEKAQRRSHNRSRSRGG
FT                   GSAHGDPPRKTVYGPYARDPDIHREIYPCNPACVNITAGVVGNCMSGTQGVGLAQASQQ
FT                   MCKYLWTEPSVLQVSRELDNV"
     atgggaaacc cagaacatga cttcagtagc aagcataccg aggcagtctc gaataccgag        60
     gcagtatcca accatccacc atattcttcc ataacagagt ccatcgatga gccacctaca       120
     tacggacaat caaacgcatc atacagagta tcgcacgacg gctttcctag atctgtggtg       180
     gtcgttgttg atgaatgtat cacccacctg aagcttttat ctgcgatcgc caaacttcgt       240
     aacttcatta agggaacgga caaactcttt ggaattcacg atgctgagat cagaaacttt       300
     tccaacaacc agcaagccca ggcagccgcg cgcattcggg aaaagagatg ggctgtttat       360
     gtggctagag ctgtggaccg atttactatt tggtggcagt cttacctacc gagtctcaaa       420
     accagtcaca tctcaacgtt aaatactgca tctgaggcca atatagcatg gtctgctaac       480
     atgatgccac cacttgatgt tatcatggtc tggcatgcat ttatgcttaa cccgcgtgcc       540
     tttcttgagg attgtttgcg tcagtctaaa atgagtgtct gggccactgg gatgccgtgg       600
     gatataataa acgcatccat cgacgacaag acccttgtct tctacccaga cagagacagt       660
     gaagcgagga taaacttcga ggcaataaca ggtcattcct gggaaaatat ccacgacagt       720
     ccagcgaaat ctctgccttg catcggttgt aaacaggaaa ttattgctcc ctggacggaa       780
     ggatcaattg gatgcgatac agatgtcgcc tttgcacact gcaccggata tgcggacaag       840
     tctttgcggg tttcatgtcc agcatgtaaa ttcaacacaa cacacgatac tcttcgcgtg       900
     caaaagtttc gcagtgatgt gcagaagttg ttgaaagatg atattcctat gcccggcacg       960
     cttttgtcac agaatggcac tcccgccgac gatggaaatg gcgataacgt gtcctttccg      1020
     aaccggctta ttaaagaggg aatcagaagc gagctcctgc agcttacgga cctcacggaa      1080
     aacgaaagca ccaccattga aaccatccgc gaccacctcg aggcatattt gaagagtcgt      1140
     tcagtaatgc gtcgcgtgaa caagacaata ctggcttctg ggaattcaag catgccagaa      1200
     aggatatctc ttcgcaatat gctctccaga tattgggaca attcatcccc tttcgccatc      1260
     gacctggtcg gggcagtcat acgacaaggg acgtttgtgg acaagatgga caatatcggg      1320
     tgggtacgtt caccaaaccc gagatcgact atgggtcact tcatcggcaa gtacggcgtg      1380
     ttcttccaaa taatggtcaa gaataaaggc catgctgttg tccccactct cgatgtcgac      1440
     ctgatttggc acacgcacca gctttctccc attcgctatt acatcttctc taccacgcag      1500
     atggagggaa tattcatcaa ccacgacgac aaaatcgacg agacaaagct caatgacgcc      1560
     ttcgcatgga cctcaagaca ataccaaaaa ctcaccggcg gaaagatcta cagtgaatgc      1620
     acatgctggt attgcgaggc agtgcgcgag tccaacaacc agggacttgg gaggctgata      1680
     tcaccgtcca ccctgcatgc caaaaccaac gccgcccttc tccacaacag tgctgataat      1740
     gccaccgacg gtaaaagcaa agagccgcac atttcgtccc ataacgcagt tcgcatcctg      1800
     gcccaggctg atccaaaggc aatgcagacc aagaccgccc agcttgaatc gtgctgggag      1860
     aaagcgcagc gacggtctca caatcgcagt cgcagtagag gcggtggtag tgcccatgga      1920
     gatccgccaa ggaagaccgt gtatggcccc tatgcgcggg atccagatat ccatcgcgaa      1980
     atatacccct gcaatccagc ctgtgtgaat atcaccgctg gcgtggtggg taactgcatg      2040
     agcgggacac agggcgtcgg tcttgcgcaa gctagtcagc aaatgtgtaa atacttgtgg      2100
     accgaaccta gtgtcctcca ggtcagtagg gaactggaca atgtatag                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page