(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE263

PENCW_16.PE263       Location/Qualifiers
FT   CDS_pept        join(599867..600228,600297..601633,601690..601733)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977596"
FT                   /orf_name="Pc20g02630"
FT                   /product="Pc20g02630 protein"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85592.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI00018319E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH9"
FT                   /transl_table=1
FT                   /translation="MMKTLALLTLAVVPSLALNIPTQQRLFPESKLSGNHYNPLSTPST
FT                   RETCPQPRKVNTPNDGLHSSQTFLSDDAFRARQAKRLSRAVQIPTTVGDYMKDPYDEAF
FT                   EPIVEFQSLLEEMFPLVHDHANVEHINRLGLVFTFEGADTSLKPLLFMAHQDVVPIDDA
FT                   SDWTHPPFAGVFDGEWIWGRGSSDCKNVLIGLMSVVEDLLSQDWQPQRTVLFAFGFDEE
FT                   SHGFLGAGAISAALEEKYGKDSFEFILDEGGMGLQSLGDESNPNGEILYALPAVGEKGS
FT                   LDLIIDIAVPGGHSSIPPAHTGIGIMAEILYELERKELFPAWLDTTHPAYGMLECQAQY
FT                   SPEHVETWLSDKLAANDPAALGEAVASSRGPAVRYTVQTSQAADLIHGGVKTNALPEKI
FT                   SAVVNYRVALHQTPDELRERAIRLIRPIAESHNLTLRVDFPGVAESTEGDVSDRTLTLS
FT                   PLSVPLSPAPISPTNPLTSKVWAHFAGVARSVFESHSNPLSKSESGSKPTVVVTGDVMT
FT                   GNTDTRFYWSLSDNIYRWSPSRAGGSLNIHTVDERIRLDVHLEGMMLYYDLIRSFDAWD
FT                   GKSE"
     atgatgaaaa cactcgccct tctcaccctg gccgtagtgc catcgctagc actcaatata        60
     cccacacagc agcgtctttt ccccgagagc aagctatcgg gcaatcatta taacccgcta       120
     tcaaccccat ctacacggga aacatgccca caaccccgca aggtcaacac ccccaacgat       180
     ggcctgcact cgtcgcagac cttcctgtcc gacgatgctt tccgtgcccg ccaggcaaag       240
     cggctctcgc gcgcagtgca gatcccaacc actgtgggtg attatatgaa agacccatac       300
     gatgaggcat tcgagcctat agtcgaattc caatcgctat tggaggagat gttccctcta       360
     gtacacgacc acgccaatgt tgagcacatt aaccgtctcg gtctagtctt caccttcgag       420
     ggtgctgata cttcactcaa gccgctactc ttcatggccc atcaggacgt cgtccctatc       480
     gacgacgcct cagactggac ccaccctccc ttcgcgggtg tgtttgatgg cgaatggatc       540
     tggggccgcg gctcaagcga ctgcaaaaac gtccttatcg gactaatgtc cgtagtcgaa       600
     gacctgctct cgcaggactg gcagccacag cgcacggttc tgtttgcctt tggcttcgac       660
     gaggaatcac atggcttcct aggcgctgga gcaatctcag cagctctgga ggaaaagtac       720
     ggcaaagact ctttcgaatt catcctcgac gagggcggaa tgggactcca gagtctgggt       780
     gatgagtcca accctaacgg cgagatcttg tatgctctcc cggctgtcgg tgagaagggt       840
     agtctcgacc tgattatcga tattgccgtt cctggtggcc acagctcaat accgcccgcg       900
     cacaccggca tcggtatcat ggcggagatt ctgtacgagc ttgagcggaa ggaactgttc       960
     cctgcctggc tggataccac ccaccccgcc tacgggatgc tagaatgcca ggcacaatac      1020
     tcaccggagc acgttgagac ctggctatcc gataagctgg cagcaaacga ccctgccgct      1080
     ctaggcgagg ctgttgccag ctcccgcggc cccgcagtcc gctacacagt gcagacatcc      1140
     caggccgcag acctgatcca cggcggtgtc aagacaaacg cactgccgga gaaaatctca      1200
     gcggttgtca actaccgcgt agcactacac cagacgcccg atgagctacg cgagcgcgct      1260
     atccgactta tccgccctat tgctgaatct cacaacctca ctctacgtgt tgacttcccc      1320
     ggtgtggcgg agtccacgga aggggatgtg agcgaccgta ccctcacctt atcgcctctt      1380
     agtgttcctc tttccccagc tccgatctcc ccgacaaacc cgcttacatc gaaagtgtgg      1440
     gcgcactttg ccggagtggc gcgcagtgtc tttgagtcgc actcgaaccc gctttccaaa      1500
     tctgagtctg gatctaagcc gacggttgtt gtcacgggag atgtcatgac tggaaataca      1560
     gatacgcgct tctactggtc tttgtcggac aatatctacc gttggagtcc gtcgcgggct      1620
     ggtggatcgc ttaatattca cactgttgac gagcggatcc gcttggatgt tcatcttgaa      1680
     ggcatgatgc tttactatga tctcattcgg tcttttgatg cttgggatgg aaaatccgag      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page