(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE264

PENCW_16.PE264       Location/Qualifiers
FT   CDS_pept        join(complement(604461..604654),complement(604104..604396),
FT                   complement(603031..604054),complement(602779..602981),
FT                   complement(602585..602728),complement(602396..602531),
FT                   complement(602275..602344))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824380"
FT                   /orf_name="Pc20g02640"
FT                   /product="Pc20g02640 protein"
FT                   /protein_id="CAP85593.1"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="UniParc:UPI00018319E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI0"
FT                   /transl_table=1
FT                   /translation="MQLYRLGLLVASFVSSIGAQSTFSPARPPAIPLAVRSPYLSTWLN
FT                   VGKDGGNGGYLAGQWPVFWENQVNGWTGMIRVDGNTYTWMGLPGSKTVNQTAFEYTSTK
FT                   SIFTMNVENKLEMNITFLSPVTPTDLKRQSLVFSYLNVEVSSLDGQKHDVQVYTDISAE
FT                   WVSGDRNAIAEWEYGTTDGVAYHKVHRQTQLAFTEKSQQGEWGNWYWATDDSKDMTHQS
FT                   GADTDVRGQFATTGKLSNGDDTNFRAISSVWPVFGFSYDLGSVDSSPVSTLFSLGLTQD
FT                   EAIQYEGASQYAPVPSLWKSYFATELAALSFFHKDYTESSNLASSLDRRVAQDSIATAG
FT                   QDYLVVTSLSVRQAFGATQLCGTQDKMYMFLKEISSNGNMNTVDVIFPAYPIFLYTNPE
FT                   LLKLVLTPLLENQEAGKYPNDYSIHDLGSSYPNATGHSDGSDEKMPLEECGNMLIMSLA
FT                   YVQKSGDSDFLNDHYSLLKQWTSYLVEDSLYPANQISTDDFAGPLANQTNLALKGMIGI
FT                   QAMAVIANMTGHTADAADYSRIAKDYITQWQDLAIAKGANPPRTTLSYGDTASHGLLYN
FT                   LFADAQLGLNLVPQSVYQMQSDFYPTVANKYGVPLDTRHTYTKGDWECFAAAVSSVDTR
FT                   DMFINDLATWINETPTNRALTDLYDTISGDYPQNTFVARPVMGGCFAPILVR"
     atgcagctgt atcgcctcgg tctgctggtc gcttctttcg tgtcctctat tggagcacag        60
     tcgaccttct cccctgcccg tcccccggct atacccctcg ctgttaggtc accgtatctt       120
     agcacttggc tcaatgtagg aaaagacggt ggtaatggcg ggtacttggc tggtcaatgg       180
     cctgtcttct gggagaacca ggttaatggg tggacaggga tgattcgcgt cgacggcaat       240
     acctatactt ggatgggcct gcccggatct aaaaccgtta atcagaccgc gtttgagtat       300
     acttcgacta agagtatctt tactatgaac gtggagaata agcttgaaat gaacattact       360
     ttcttgtcgc ctgttacgcc cactgatctc aagcgccagt ccctcgtttt ctcgtatctt       420
     aatgtcgagg tctcttctct tgacggccag aagcatgatg tgcaggtcta cacggatatt       480
     tctgctgaat gggtctcggg cgaccgaaat gccatagcag aatgggagta tggtaccact       540
     gacggtgtgg cctaccacaa ggtacaccga cagactcagc tggcctttac cgaaaaaagc       600
     cagcagggcg aatggggtaa ctggtactgg gccaccgacg actcgaaaga catgacccac       660
     cagtctggtg cggataccga cgtccgtggt cagtttgcga caactggaaa actctcaaat       720
     ggcgatgaca ccaatttccg ggctatctcc tctgtctggc ccgtatttgg gttctcatac       780
     gatctgggct cggtcgattc ttcgcccgtc agcacgctct tctcactcgg cctgacacag       840
     gatgaagcca ttcagtacga aggcgcttcg cagtatgccc cagtaccctc cttgtggaag       900
     agttatttcg ctaccgaatt ggccgccctt tcattcttcc acaaggatta taccgaatcg       960
     agcaatcttg cgagctcttt ggatagaaga gtggcccaag attcaattgc cactgctggt      1020
     caagactacc tcgttgttac ttcgctctcg gttcggcagg cattcggtgc cacccagctt      1080
     tgtggaacgc aggacaaaat gtacatgttc ctgaaggaaa tctcttccaa cggcaacatg      1140
     aacactgtgg atgttatctt cccggcttac ccgattttcc tatacaccaa ccccgaactc      1200
     ttgaagctcg tcctcactcc tctgctagag aaccaggagg ctgggaagta tcccaacgac      1260
     tattccatac acgatctagg ctcgtcttac ccgaacgcca cgggtcactc cgatggcagc      1320
     gacgagaaaa tgccattgga agagtgcgga aatatgctca ttatgtcttt ggcttatgtg      1380
     cagaagtcgg gcgactctga ctttttgaat gaccactaca gtcttctcaa acagtggaca      1440
     agttatctgg tcgaggactc gctttaccct gcaaaccaaa tctcaacaga cgactttgcc      1500
     ggccccttag ccaaccaaac caacctcgca ctcaagggca tgatcggtat tcaggccatg      1560
     gcagtcattg ccaacatgac tggtcacact gctgacgccg ccgattactc gagaatcgcc      1620
     aaagactaca tcactcagtg gcaggacctg gctattgcca agggtgccaa cccgccccga      1680
     acgaccctgt cgtacggcga caccgctagc catggcttgc tctacaacct ctttgccgat      1740
     gcacagctgg gcttgaatct cgttccacag tctgtctatc agatgcagag cgacttctac      1800
     ccaactgttg caaacaagta cggcgtgcct ctagacaccc gccacacata caccaaaggt      1860
     gactgggagt gctttgcagc agcggtcagt tcggtcgata ctcgggatat gtttatcaat      1920
     gatctcgcaa cctggatcaa cgagacaccg accaaccgag ccctgactga tctgtacgac      1980
     actatctcag gagattaccc ccaaaatact ttcgtcgctc gccccgttat gggtggctgc      2040
     ttcgctccta tcctcgtccg ctag                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page