(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE270

PENCW_16.PE270       Location/Qualifiers
FT   CDS_pept        join(complement(618476..618587),complement(618091..618421),
FT                   complement(617986..618042),complement(617774..617935),
FT                   complement(617373..617721))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948840"
FT                   /orf_name="Pc20g02700"
FT                   /product="Pc20g02700 protein"
FT                   /protein_id="CAP85599.1"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniParc:UPI00018319ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES5"
FT                   /transl_table=1
FT                   /translation="MRLSISLALVGLSTTQLVCASLTDRAASDLPPYVLEYAPLVWLHS
FT                   QETYMPSDIQQQLDHTRPHVNWTALEGVESPLTLNNLDTLNSMGNTSVYLTSLEGIEAD
FT                   PQPAWFQGIRPDSQGRTENGTASIIVIADRGNGTVDAFYFYFYAFNKGGTVLGLEFGDH
FT                   IGDWEHNMIRFVDGSPDAIWYSQHASGQAFTYAAVEKKDKRPYVYSAKGTHANYAIEGQ
FT                   HDHTIPGFNLPTGFLLDYTDRGVLWDPVLNGYTYTYDETAGFQAVNSEDPVAWLDFNGR
FT                   WGDDQPPNEPSVFGEAKNVAGPNGPKFKGLDRELVCPSKPCIVLPFRTFSVDTTS"
     atgcgtcttt ctatatcgct ggcactagtg ggtctatcta caacccaact agtctgcgca        60
     tcactcaccg acagggctgc atctgacctc ccgccatatg tcttggaata tgcacctttg       120
     gtctggctcc atagccagga gacatacatg ccgagcgata tccagcagca gctcgatcac       180
     accagaccgc atgtcaactg gacagccctc gagggagtgg agtcacccct gactctcaac       240
     aaccttgaca cgctcaattc catgggtaat acaagcgtct atctaacctc tctagagggc       300
     atcgaagccg atccacaacc agcctggttc caaggtatca gaccagattc acagggccga       360
     acggaaaatg gtacagcgag tatcatagtg atcgcagatc gaggcaatgg aaccgttgat       420
     gcgttttact tttacttcta tgcgttcaac aaaggcggta cagtactagg tctcgaattt       480
     ggcgaccata tcggagactg ggaacataat atgatccgtt tcgttgatgg ctcaccggac       540
     gcaatatggt acagccagca tgccagtgga caggcgttta cctacgccgc cgttgaaaag       600
     aaggacaagc ggccgtatgt ttactctgcg aaaggcacgc atgcaaacta tgcaatcgaa       660
     ggacaacacg accacaccat cccgggcttc aacctcccta cagggtttct gttggactat       720
     acagaccgcg gggtgctgtg ggatcctgtc ctcaacggct acacttatac ctatgacgaa       780
     acagctgggt tccaggctgt gaactccgaa gatccggtgg cgtggttgga tttcaatggg       840
     agatggggtg atgaccagcc gccgaatgaa ccctcggtct ttggtgaggc taagaacgtt       900
     gctggtccca atggtcctaa gttcaagggg ttggatagag agttggtgtg tccttccaag       960
     ccgtgcattg tgctcccgtt caggactttc tctgtggata cgacttcgtg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page