(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE271

PENCW_16.PE271       Location/Qualifiers
FT   CDS_pept        join(complement(620634..620704),complement(620451..620583),
FT                   complement(620333..620390),complement(619968..620227))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128980"
FT                   /orf_name="Pc20g02710"
FT                   /product="Pc20g02710 protein"
FT                   /protein_id="CAP85600.1"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="UniParc:UPI00018319EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES6"
FT                   /transl_table=1
FT                   /translation="MTDAYAFSYPSPLEGYENLEPLTDERTEDGKSLKNPQHGVLSKAY
FT                   TEFPDPLSKGREGGFDVHIYHFQNNPDQAAYARALWERIRREFPELRIYTFFDRPVGPH
FT                   PVAMFEVNLFTPAQFGAFVPWLVINRGPLSALIHPNTVESEDERNHTQRATWLGDRIPL
FT                   DLSIFRPRKN"
     atgacagacg catatgcctt ctcataccca tctccattgg aggggtacga aaacctcgag        60
     ccgttaaccg acgagcgcac cgaagacggc aagtcactta agaaccccca acatggcgtg       120
     ttaagcaaag cctacacgga attccccgac cctctttcca aaggccgaga gggaggtttc       180
     gacgtccaca tctatcattt ccaaaacaac cccgaccaag ccgcatacgc tagagcgctc       240
     tgggaacgaa tccgacgtga attccccgag cttcggattt acactttctt cgatcggcct       300
     gttggacctc acccggtggc catgttcgaa gtgaatttgt tcacgcccgc gcagtttgga       360
     gccttcgttc cttggttggt tatcaatcgg ggcccgctta gtgctctcat tcatcccaat       420
     acagtcgaat cggaggatga gcgcaatcat acccagcgcg caacttggct tggtgatcgg       480
     attccattgg atttgtcgat ttttaggccg aggaagaact ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page