(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE272

PENCW_16.PE272       Location/Qualifiers
FT   CDS_pept        join(complement(622602..622699),complement(621336..622542))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948841"
FT                   /orf_name="Pc20g02720"
FT                   /product="Pc20g02720 protein"
FT                   /protein_id="CAP85601.1"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniParc:UPI00018319EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES7"
FT                   /transl_table=1
FT                   /translation="MDDDYVAKVLAKEAKESSIKYASQGMSAFMPSRPTSNAPKPNTRF
FT                   LRNLIKVTDNHNTALKLKEEREARERMRQLKDKASGALGPTSPDHPSKRSDDRSEVRGS
FT                   RDHRRGDREDRNRSHRKRTRSRSPSAERDRSRRHRRRNEEYDGIRERDKDRDGHRREHR
FT                   DHGSSRKGRRDRDKEHTRRRRERSYSRSPSYSPHRDPSTDRHRHRRHKRQSGRSARSVS
FT                   RSRSPESYRSRRSKREDASPHGSRRSHLETSTQHKRVSPLSTITARQSEMGDESDPLED
FT                   LVGPLPPRQDEAPIRSRGRGAYKHNMSNIDAHFAPGYDPATDVHLDEDKLHSIGQESSR
FT                   RPVAGLMTKDDDWDMAMEALRDRERWRSKGEERLRTAGIDEAVIDKWKNNTAFAGMDGE
FT                   GKPEDVQWSKKGEGREWDRGKFVDDDGHIDIRASW"
     atggacgacg attatgttgc caaggtccta gccaaagagg cgaaggagag ctctataaaa        60
     tatgcatctc aagggatgag tgcttttatg ccttcaaggc cgacaagcaa tgctccaaaa       120
     cccaataccc gcttcctacg gaatctcatc aaagtaacag acaatcataa cacagctctc       180
     aagctcaaag aggaaagaga agcacgtgag cgtatgcgcc aactgaaaga taaggcctcg       240
     ggtgctttag gtccaacttc gccagaccat ccttccaaac gatctgatga tcggagtgaa       300
     gtgcgaggat caagagacca ccggagaggg gatcgggaag atcgcaatcg ctcacatcga       360
     aaaagaacac gaagtcgctc cccttcggcg gaacgagacc gatcgcggag gcatcgacga       420
     agaaacgaag agtatgacgg aatcagagag agggacaaag accgcgatgg acataggcgt       480
     gaacacaggg atcacggttc atctaggaag ggtcgacggg acagagataa ggaacacacc       540
     aggcggcgac gtgagcgatc atactcaagg tctcccagct attctccaca cagggaccca       600
     agtaccgacc gtcatcgcca tcgaagacac aaacgtcaat ctggacgttc tgctcgctcc       660
     gtttctcgct cccgctcacc agagtcgtac agatctcggc ggtcaaagcg ggaagatgca       720
     tcgccacatg gctcccgccg ttcacacctt gagaccagca cgcagcataa acgagtgtcg       780
     ccgttgtcta ctataactgc acgccaaagc gagatgggcg acgaatccga tccgctagaa       840
     gatcttgtcg gaccacttcc tcctcggcaa gacgaggcac ctatccgctc gcgcgggcga       900
     ggtgcctata aacacaacat gagcaatatc gatgctcatt ttgcacccgg ctacgaccca       960
     gccaccgacg tgcatctaga tgaagacaaa ttacactcca taggccagga gtcctctcgt      1020
     cgtcctgtcg cagggctcat gacaaaagac gatgactggg acatggcaat ggaggcgctg      1080
     cgtgatcgtg aacgctggag aagcaaaggc gaggagaggc tacgtacagc aggaatcgat      1140
     gaggcagtta ttgataaatg gaagaataac actgcttttg cgggcatgga cggagaaggc      1200
     aaaccggagg atgtgcagtg gtcgaagaaa ggcgaaggac gggaatggga tcgcggcaag      1260
     tttgtggatg atgatggtca cattgatatt cgggcttctt ggtag                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page