(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE273

PENCW_16.PE273       Location/Qualifiers
FT   CDS_pept        join(623023..623241,623313..623532,623596..624032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948842"
FT                   /orf_name="Pc20g02730"
FT                   /product="Pc20g02730 protein"
FT                   /protein_id="CAP85602.1"
FT                   /db_xref="UniParc:UPI00018319F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES8"
FT                   /transl_table=1
FT                   /translation="MTDSSPEALAALQQLEQNGKLKDRLAIIRISDPISTEVGGSYPSP
FT                   SKRSSDASLSNFDDPTPASLEADLSHYKELFSKLRFSYLEQVTKEKFLRAIVGDPPVIV
FT                   GHNENMELETQLADVKAELKARKEDARIMIEEMEQMGRDLASRYKNVELQTTQLSTLPA
FT                   SIENLESTIAELRAKQIATMDPSDPNNSSSQNLPLPATLALLAEREAELAALNRQLAAV
FT                   HSALPRKTREAEAVERERSVLERRKSDAIAQAREAQRKKQQGESDGLEEIGRWYRGAEE
FT                   TLKELVGTQT"
     atgacagact catcgcctga agccctggca gcacttcagc agctggagca gaatggcaaa        60
     ttgaaggacc gacttgcgat tattcgcatc agcgacccaa tttccactga agttggagga       120
     tcttacccct ctccctcaaa aagaagctcc gatgcttccc tctcaaattt cgacgatcct       180
     acccctgcct cgttggaggc tgatctttca cattacaagg aactattctc caagctgcga       240
     ttctcctacc tcgagcaagt aacaaaggaa aagttcttgc gcgccattgt tggcgacccg       300
     cctgtgattg tcggacacaa tgagaacatg gaactggaga cgcaactagc ggacgtgaaa       360
     gccgagctta aggcacggaa agaagacgca cggattatga ttgaggaaat ggagcaaatg       420
     ggccgtgact tggcaagccg ttacaagaat gtggaacttc aaactacaca gctctcaacg       480
     ctgcctgcgt caatcgagaa tctcgagtca accatcgccg agctccgcgc caagcagata       540
     gccacaatgg atccttcgga tcctaacaat tcctcctcgc agaatctccc tcttcccgcg       600
     accctggctc tgttggcgga acgtgaggca gaactggcag cgttgaatcg ccagctggct       660
     gctgtacaca gcgcattgcc tcggaagacc cgagaggctg aggcagtaga gagagagcgt       720
     agcgtgctcg agcgacggaa gtcagatgcg atcgcgcaag cccgtgaagc ccagcgcaag       780
     aagcaacagg gtgaaagtga tgggctagaa gagataggac gttggtatag gggagcagaa       840
     gagaccttga aagaattggt ggggacccag acatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page