(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE274

PENCW_16.PE274       Location/Qualifiers
FT   CDS_pept        join(complement(625256..625263),complement(625161..625198),
FT                   complement(625086..625104),complement(624910..625008),
FT                   complement(624401..624809))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977846"
FT                   /orf_name="Pc20g02740"
FT                   /product="Pc20g02740 protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP85603.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00018319F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES9"
FT                   /transl_table=1
FT                   /translation="MAPRVSSKTYKVPRRPFESARLDAELKTVGEFGLRNKREVWRVQL
FT                   TLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDEGRMKLDYVLALKADDFLE
FT                   RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFSLTSPFG
FT                   GGRPGRVRRKKAAAAAGGEDAEEEEEE"
     atggcccctc gcgtttcctc caagacctac aaggtccccc gtcgcccctt cgagtcggcc        60
     cgtcttgatg ctgaactcaa gaccgtcggc gagttcggtc tgcgcaacaa gcgcgaggtg       120
     tggcgtgtcc agctcaccct ctccaagatc cgtcgtgctg ctcgtgagct ccttactctc       180
     gacgagaagg accccaagcg tctcttcgaa ggcaatgccc tcattcgccg tcttgtccgc       240
     atcggtgtgc tcgacgaggg ccgcatgaag ctcgattacg tccttgccct caaggctgac       300
     gatttcctcg agcgccgtct ccagacctgc gtctacaagc ttggtctcgc caagtccatc       360
     caccacgccc gtgtcctgat caagcagcgt cacatccgcg tcggcaagca gatcgtcaac       420
     gttccctcgt tcatggtccg cctcgactcc cagaagcaca tcgacttctc tctcacctct       480
     cccttcggtg gtggccgtcc cggccgtgtt cgccgcaaga aggccgctgc cgccgccggt       540
     ggtgaggacg ccgaggagga ggaggaggaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page