(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE275

PENCW_16.PE275       Location/Qualifiers
FT   CDS_pept        join(626863..626898,627017..627084,627153..627200,
FT                   627316..627646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977847"
FT                   /orf_name="Pc20g02750"
FT                   /product="Pc20g02750 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85604.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniParc:UPI00018319F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET0"
FT                   /transl_table=1
FT                   /translation="MPHSYGLRAGTRYAFSRGFKEHGMIRLSTYMKTYRVGDIVDLKVN
FT                   GAVQKGMPHKVYHGKTGVVYNVTKSAVGVILYKKVDNRYLEKRISVRIEHVQHSRSRED
FT                   FIKRVKENAIKKREAKEKGVHVHLKRQAVGPREAHFVKQAGNKPETVVPIAYDTHI"
     atgcctcact cgtacggtct gcgcgccggc actcggtatg ccttcagccg tggcttcaag        60
     gagcacggta tgatccgtct ctccacctac atgaagacct accgtgttgg tgatattgtc       120
     gaccttaagg tcaacggtgc cgtccagaag ggtatgcccc acaaggtcta ccacggtaag       180
     accggtgttg tctacaacgt caccaagtcc gccgtcggtg tcatccttta caagaaggtc       240
     gacaaccgct acctcgagaa gcgtatcagc gtccgcattg agcacgtcca gcactcccgc       300
     tcccgtgagg acttcatcaa gcgggtcaag gagaacgcca tcaagaagcg cgaggccaag       360
     gagaagggtg tccacgttca cctgaagcgt caggccgttg gtccccgtga ggcccacttc       420
     gtcaagcagg ctggcaacaa gcccgagacc gtcgtcccca tcgcctacga tacccacatt       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page