(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE276

PENCW_16.PE276       Location/Qualifiers
FT   CDS_pept        join(628481..628665,628716..629669,629732..629771)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948843"
FT                   /orf_name="Pc20g02760"
FT                   /product="Pc20g02760 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP85605.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00018319F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET1"
FT                   /transl_table=1
FT                   /translation="MTFSTTAAPSSAPAQLGSTPPSVNKDLIPQSREMGDVIPNRTPPA
FT                   SQEKPEAKPFAHFVAGGLGGMTAATLTSPLDVLKTRLQSDFYQAQLQALRAAKPAPAPT
FT                   SNALVSVTRTAGMHFSETFQILRSIHVHEGWRALFKGLGPNLIGVVPARAINFYVYGNG
FT                   KRILSDYFDYRTAEQTPMGIHLAAAAIAGIATGTATNPIWLVKTRLQLDKSNAEIGKSR
FT                   QYRNSFDCIKQTVRHEGIRGLYRGLSASYLGVTESSLQWVMYEQMKMYLARRDALKQAD
FT                   PAYDYTSWDSAELWGGRITAAGLAKLVAAAITYPHEVVRTRLRQAPTVSLGNGKVEMKY
FT                   TGLVQCFKTVWKEEGMVAMYGGLTPHLLRVVPSAAIMFGMYEFILRMFGTTS"
     atgaccttct caaccaccgc agctcccagt tctgcgccgg cgcaactagg gagcacacct        60
     ccatcagtaa ataaagattt aatcccacaa tccagagaaa tgggggatgt cattccgaac       120
     cggacaccgc cggctagcca ggaaaagccc gaagcgaagc catttgcaca cttcgttgct       180
     ggtggactgg gaggtatgac cgcggcaacc ctcacttcgc cgcttgatgt cttgaagacg       240
     cgcctacagt ccgactttta ccaagcgcag ctacaggctc tgcgcgccgc gaaacctgcg       300
     cccgcgccga cttccaatgc cttggtctct gttacccgga ctgccggaat gcacttcagc       360
     gaaaccttcc agatcctccg ctcaatacac gttcacgaag gatggcgcgc gctattcaaa       420
     ggactgggac cgaacttgat cggtgtagtg cccgcacgcg ctatcaactt ctacgtctac       480
     ggaaacggga aacgtatcct aagcgattac tttgattacc ggactgccga acagactcct       540
     atggggattc acctggccgc tgcggcaatc gctggtatcg ctacgggtac ggcgaccaac       600
     cccatctggc tggtcaagac acgtttgcaa ctggataagt ccaatgcgga aattggaaag       660
     agtcgccagt accgcaacag cttcgactgc attaaacaaa ctgtgcgcca tgaaggcatc       720
     cgcggactct accgcggcct atccgcttcc tatctcggtg tgacggagtc gtctctccag       780
     tgggtgatgt acgaacagat gaaaatgtat ctagcccgcc gtgatgctct caagcaagct       840
     gacccggcgt acgattacac ttcatgggat tcggcggagc tgtggggagg acgaatcact       900
     gcggctggtt tggccaagct ggttgcggcg gctatcacct acccacacga ggtcgttcga       960
     acacgtttgc gtcaggcacc gaccgtctcg ctgggcaatg gcaaggtcga gatgaagtac      1020
     accggcttgg tgcagtgctt caagactgtc tggaaggaag agggaatggt cgctatgtat      1080
     ggcggcctga caccgcactt gcttcgtgtt gttccctccg ctgcgattat gttcggaatg      1140
     tacgagttca ttctgcgaat gttcggcaca acatcataa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page