(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE277

PENCW_16.PE277       Location/Qualifiers
FT   CDS_pept        join(complement(634203..634250),complement(633968..634138),
FT                   complement(633751..633900))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824629"
FT                   /orf_name="Pc20g02770"
FT                   /product="Pc20g02770 protein"
FT                   /protein_id="CAP85606.1"
FT                   /db_xref="UniParc:UPI00018319F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET2"
FT                   /transl_table=1
FT                   /translation="MKWQSTLFILGALSTQALGAKIMCNVDHDYADKGAIESGISYIRG
FT                   LSGQPTAEANKCNRVSCSWGSGIYLCADDGKDHTLQNWGVLADATQAVLDSCGNDSGVK
FT                   GRLMHEKGWGVAVQGAPC"
     atgaagtggc agtcaacttt gttcatcctt ggtgcccttt ctacccaggc actcggcgcc        60
     aaaattatgt gcaacgtgga ccacgactat gctgataagg gtgcaattga atctgggatt       120
     tcctacatcc gcgggcttag cggtcagcct actgctgaag ctaataagtg caaccgggtt       180
     agctgctcct ggggctcggg catctatctt tgcgccgatg acggcaagga tcacacactg       240
     cagaattggg gagtcttggc ggatgccaca caggcagtgc tagacagctg tggaaacgac       300
     tccggagtca aaggacgact gatgcatgag aaaggttggg gtgttgcggt tcagggagca       360
     ccgtgctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page