(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE278

PENCW_16.PE278       Location/Qualifiers
FT   CDS_pept        join(635679..636186,636241..636397,636462..636714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000222418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948844"
FT                   /orf_name="Pc20g02780"
FT                   /product="Pc20g02780 protein"
FT                   /protein_id="CAP85607.1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="UniParc:UPI00018319F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET3"
FT                   /transl_table=1
FT                   /translation="MSRENVEFQTADHVTLRGWFFRPSMEPLETKLPCLVMSHGFSALK
FT                   EMGLDAFAEYFALNLPISCLVYDNRGFGDSDTKEGQPRQEVLPSQQISDISDAITYAQS
FT                   RADVDPNRIGIWGSSYSGGHVLYVGAVDRRVKVVLSHVPFTDGWETLSRLLPSDAIDGV
FT                   NKAFQEDRLARAAGKPAGMIAVVEKDPLKPSTLPTPDSYQFFSEWEAKSNWKNEITLKS
FT                   LEAARGYNPTAHIHHISPTPLLMTVAENDVVAPTDIALDAYSRAGEPKKLRMFPGGHFD
FT                   GYAGEGFERNASVHAEFLKEHLVG"
     atgtctcgcg aaaacgtcga attccaaacg gccgaccatg tcaccttgcg aggttggttt        60
     ttccggccgt caatggagcc actcgagaca aagctgcctt gcctggttat gtctcatggg       120
     ttctcagcct tgaaagaaat gggacttgac gcgtttgcgg aatactttgc tctaaatctg       180
     cccatcagct gtctagtata tgacaaccga ggatttggtg atagtgacac gaaggaaggc       240
     cagcctcggc aggaggttct tcccagccaa cagatcagcg atatatcaga cgccatcacc       300
     tatgcgcagt ctagagccga tgttgaccct aatcgcattg gtatctgggg aagttcttac       360
     agcggtggac atgtgctgta tgttggagca gttgaccggc gtgtcaaggt ggtgctctcc       420
     catgttcctt tcaccgatgg gtgggagacc ttgagtcgtc tcttgccgtc tgacgcaata       480
     gatggagtaa acaaagcatt tcaagaagac cgattggccc gggctgcagg gaagcctgct       540
     gggatgatag cagtggtcga aaaagacccc ctgaaaccat ctacacttcc tacaccagat       600
     agctatcagt tctttagtga gtgggaagcc aagtcgaact ggaaaaacga gatcacgctg       660
     aaaagtctcg aggctgctcg tgggtacaat cccactgcac atattcacca catctcacca       720
     accccgctgt tgatgacagt ggcggagaac gatgtcgtgg ctccgactga tattgctctg       780
     gacgcatatt ctcgggcggg agaaccaaag aaactgcgga tgttcccggg tggtcatttt       840
     gatggttatg ccggtgaagg ctttgaacgc aacgcgtcag tccacgcaga atttctgaaa       900
     gagcatttgg ttggataa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page