(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE279

PENCW_16.PE279       Location/Qualifiers
FT   CDS_pept        join(639475..639620,639662..642131)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948845"
FT                   /orf_name="Pc20g02790"
FT                   /product="Pc20g02790 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85608.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831ABE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET4"
FT                   /transl_table=1
FT                   /translation="MNSNFNFNNEEVNETMQWPGPPGSFTSSEGFTGTDNDRVGAHPET
FT                   TASRTSSSADLTSLTSSEAYPQESGWMNIDPFSQVREAPQRYDSDLDGIDPRYHLEDEN
FT                   NIPQSLAEDLGSSTITQRPADDPSESTVLPLGGLDRTTIGIPNPAHFSLQPPTQPSYEG
FT                   IVDQVVNTYRALMSDQTCSPHQISQGLQNLETIKYFFHTKLPASPISIASSEPDTRDKP
FT                   LFRCWQCDPQKKKATFPSFGAFKRHLTMHGILDCEWRCTYCDVTLHRRDRMRNHLIHVH
FT                   NKFNLLPADVEATRVRYPPPTNCPIPICLDRTPSWAVYFEHIKSHCLISPVSGNASTNG
FT                   DRSDHSGNGGGNGNRHVHGSSSAGPSNSNRGSQSSQSSNQSGGTPYPSTIFGGFSNRGN
FT                   VCAGPVSHSTSDDQLNTSRRQSATEAIEQISIDDLLRSPHGPRASHLPRGVSGQPNNLL
FT                   PPQDPRLSRSNHSSKRKRQDKQKEPTDEQAPSSNKCRRCNHDMARCGHCQSVDSCHKCG
FT                   DLPRSGIQVGASTTMPAQALPDASSAFINLDESYLNSEALANLVTPQNMPTQLPHYNPN
FT                   EIMHSFDPQSFGDMTNTFMDEFPNDPFIRVAMDVVSHPPLRDLGDKIQGSPVFESDAKL
FT                   LRTIGLGTLIDPLSTKRQLIQPQAKASSGPAPGSYADLRNNGSSSILEAPQPVSRCQCP
FT                   CVTVPAVDYEAHASLQLSPDERVEMAFKMTPARESSHPLRTRVRVFVKLFSLRASAARS
FT                   NTEKQRTRSFSSETTDEDAESETDSDQELTPTSPSSSEITPLLHWTEDVQDWSFSFDIK
FT                   WALTKLAQWTSGIDADTCRKLLLSDPGHILDLMSMYIVYKFKISWLLMGRNGLSVFLSI
FT                   "
     atgaattcta atttcaattt caataatgag gaggtcaatg agacaatgca gtggcctggg        60
     cctcctggct cctttacctc atccgaagga tttactggga cagacaatga tcgagtgggt       120
     gcccatccag agaccacagc ttcaaggact tcctcatcgg cagacttaac aagcttaacg       180
     agttcggagg cctacccaca agagtccgga tggatgaaca tcgatccttt cagtcaagtg       240
     cgagaagctc cacaacgata tgacagtgat ctggatggta ttgatccaag atatcacttg       300
     gaggacgaaa acaatatccc ccaaagccta gcggaagatc taggaagctc aactatcact       360
     caacgaccag cagatgatcc aagtgagagt actgtccttc ccttgggagg gttggatcgg       420
     accacaatcg gaataccaaa tcccgcacat ttttctctgc aacctccaac ccagccttcg       480
     tatgaaggta tcgtggacca ggtggttaac acctatagag ctctcatgtc tgatcagaca       540
     tgtagtcctc atcaaatttc ccaagggctg caaaaccttg aaacgatcaa gtacttcttt       600
     catacaaagc tcccggcatc tcctatttca attgcgtctt cagaaccaga tacacgagat       660
     aaaccgttgt tccgatgttg gcaatgtgat cctcagaaaa agaaagcaac ctttccaagt       720
     tttggtgcct tcaagagaca tttgactatg catggtatac tcgactgcga gtggcgctgt       780
     acgtactgcg atgtgaccct ccaccggcgg gataggatgc gtaaccacct cattcacgtc       840
     cacaacaaat tcaatctgct cccggctgat gtggaggcaa ctcgagtgag gtatccccct       900
     ccaaccaact gccccatccc aatttgcctc gacaggacac cttcttgggc tgtctatttc       960
     gagcacatca agagccactg tctcatatcc cctgtttcgg ggaatgcatc taccaatggc      1020
     gatcgttctg atcacagtgg aaatggtggc ggaaacggca ataggcacgt tcatggctct      1080
     tcttcggccg gacccagcaa ttcgaacaga ggatcgcaat ctagccaatc aagtaaccag      1140
     agtgggggta ctccttaccc tagcacgatc ttcggaggct tcagcaacag gggcaatgtg      1200
     tgtgctggtc ccgtctcgca ctctacctct gacgatcagc tcaacaccag ccgtcgtcaa      1260
     agcgccactg aagccattga acaaatttca atcgacgact tacttcgatc acctcatggg      1320
     cccagagcat ctcaccttcc cagaggagtc agtggacaac ctaataacct cctgccccca      1380
     caggaccccc gattgtcacg gagcaatcat tcgagcaagc gtaagcgcca ggacaaacag      1440
     aaagagccaa cagacgagca agcccctagt tcgaacaaat gcagacgatg taatcacgac      1500
     atggctagat gtggccactg ccaatctgtt gatagttgcc acaaatgtgg tgacttgcct      1560
     aggagtggta tccaagtcgg ggcttccaca acaatgcctg cgcaagccct cccagatgca      1620
     tcttctgcct tcatcaactt agacgagtct taccttaact ctgaagcgtt ggcgaacctt      1680
     gtaacacccc agaacatgcc cactcaactg cctcattata atcccaacga gattatgcac      1740
     tccttcgacc cgcaatcatt tggcgatatg accaacacat tcatggacga attcccaaat      1800
     gatcctttca tcagggtagc aatggatgtt gtcagccacc cacctctgag agatctcggc      1860
     gacaagatcc aagggtcgcc tgtatttgag agtgatgcca agttacttcg caccattgga      1920
     cttggaacat tgattgaccc gctctccacc aaaagacaac tcatacaacc acaagcgaaa      1980
     gcctctagtg gtccggctcc aggatcatac gcagatctca gaaacaatgg atcttcatcc      2040
     attctagaag ctccccagcc ggtatctcgt tgccaatgcc catgtgtaac cgtcccagct      2100
     gtcgactacg aagcccacgc aagcctccaa ttatcgcccg acgaacgtgt cgagatggca      2160
     tttaagatga cgccggcacg tgaatccagt catcccctcc gcacccgcgt gcgagtcttc      2220
     gtgaaacttt tcagtctccg cgcgtcggca gcaaggtcaa acaccgagaa gcagaggact      2280
     cgttctttct cgtctgaaac taccgacgag gatgctgagt ctgaaaccga ttcagaccaa      2340
     gagctcacac ccacgtcgcc ttccagttcc gaaatcactc cactcctcca ctggaccgaa      2400
     gacgtgcaag actggtcatt cagctttgac atcaagtggg ctctaacgaa actagcccag      2460
     tggaccagcg gcatagatgc cgatacgtgc cggaaactac ttctctctga tcctggccat      2520
     atactggact tgatgtctat gtatattgtg tacaagttca agatttcttg gcttttgatg      2580
     ggtcgtaatg ggctcagtgt gtttttgagc atctaa                                2616
//

If you have problems or comments...

PBIL Back to PBIL home page