(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE28

PENCW_16.PE28        Location/Qualifiers
FT   CDS_pept        join(71099..71301,71363..72116)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946681"
FT                   /orf_name="Pc20g00280"
FT                   /product="Pc20g00280 protein"
FT                   /protein_id="CAP85357.1"
FT                   /db_xref="UniParc:UPI0001831914"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF39"
FT                   /transl_table=1
FT                   /translation="MIPSTFAPGITRRDTAKSSGGHEGAYGIPPPVISGGGLLGPQSAG
FT                   AIYQHIHEMAAKRISTLDYLRKAHEGRVYWFNTVHFSRADIARLPYFEARKLSRRAINY
FT                   LLLGLSLPTILDVNSTPFEYVRALNALLMEFEAFQQVHPPDGSSSSTLARARIPQMFKR
FT                   AAHAGTKTRRASSANEIGLPMQSSDPSDLKSTAGNLGSASSASVTSFPLTESSDLHPGE
FT                   EYTYLLTPSLPFEPDFFETFATLCDVLIDTYSRLAALVSSPSVCTVALGETFSKADARL
FT                   RKIMVAGAVREFEDASRNSVKSEVAGVSRVVLGGLLG"
     atgatcccct ctacatttgc cccgggcatc acgcggcggg acacagccaa gtcttctggt        60
     ggacatgaag gggcgtatgg catcccacct ccagtcatca gcggaggagg gcttctcggc       120
     ccgcaaagtg caggcgcaat ataccaacac atccatgaaa tggctgcgaa acggatatcg       180
     actctcgact atttgagaaa ggctcacgaa ggacgagttt attggtttaa tactgtgcat       240
     ttctcccgcg ccgacatcgc tcgtctgcca tactttgaag cccggaaact ttctcgccgc       300
     gcaatcaatt atttgcttct aggcttgtca ttgcccacaa tactcgatgt caattccacg       360
     ccattcgagt atgtacgtgc cctgaatgct ttactgatgg aatttgaagc gttccagcaa       420
     gtgcatccac cagatggcag ctcctcgtca acccttgcaa gggcacgtat accccaaatg       480
     ttcaagcggg cggcccatgc aggtaccaag acccggcgcg ccagctctgc aaacgagatc       540
     ggactcccaa tgcagtccag tgacccatca gacttaaaga gcacggcagg gaatctcggg       600
     tcggcttctt ctgcctcagt cacctccttc ccactcacgg agtcttcgga tcttcaccct       660
     ggcgaggaat atacctatct tctcacgcca tcgctgccat tcgagccgga cttctttgag       720
     acattcgcaa ctctgtgtga tgtcttgatt gacacttata gccggctcgc cgctctagta       780
     tcatctccat ctgtctgtac agtggccctg ggcgagacgt tttccaaagc agatgccaga       840
     ttacgaaaga tcatggtggc cggcgcagtg cgtgagttcg aagacgcgag ccgaaatagt       900
     gtcaagagtg aagttgctgg ggtcagtcgg gtggtgcttg gcggtttatt gggatag          957
//

If you have problems or comments...

PBIL Back to PBIL home page