(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE280

PENCW_16.PE280       Location/Qualifiers
FT   CDS_pept        join(complement(644303..644751),complement(643622..644223),
FT                   complement(643389..643561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128981"
FT                   /orf_name="Pc20g02800"
FT                   /product="Pc20g02800 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85609.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831ABF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET5"
FT                   /transl_table=1
FT                   /translation="MATDDDNFDIDIYGDGTYNANEPGEFKQDDSELVLDAPENQPQPS
FT                   TGPSNDANQENPTSTQGQQVNNNGAPSAPQQPSNHGLPAPPQGVKRKEFEDQSVDPDAT
FT                   TALLISDLSWWITEDDIRGLANQAGVEDQLKDVTFSEHKVNGKSKGQAFVEFTTARAAT
FT                   ATRHHIERNDTPARRHTVQYTTPHQNPFRTLPKDAPMRNAGGRGGGAAHPTGGNYGMNN
FT                   AGGGFRGRGSGFNRGMGHMNNFNNRNNFNPMGGFQGGGPNPMMGGFQGAPMGGMPNYGF
FT                   NNRGNMMGGGMRGNMRGGRGVGMGGGPNMMGMPAMTPPMGGMGMNPMAGMNPMMGGGMA
FT                   GGMGGNMPMQGQQGFQGPNPGFNQGYYNPNNPNNPNNPNNQNQASGSGSGSDGGSWNPH
FT                   GAKRSRQD"
     atggctaccg acgatgacaa cttcgatatt gacatctacg gcgacggcac ctacaatgcc        60
     aacgagcccg gagagttcaa gcaggatgat tccgagcttg ttctggatgc ccccgagaat       120
     cagcctcagc ccagcaccgg accatccaac gatgccaacc aggagaaccc tacttccacc       180
     cagggccagc aagtgaacaa caatggagct ccatcggcgc ctcagcagcc atccaaccac       240
     ggtctgcctg cacccccgca gggagtcaag cgcaaggaat tcgaggacca gtccgtggac       300
     ccagatgcta caactgcact gctaatctcg gatctatcct ggtggatcac cgaggacgac       360
     attcgaggct tggcgaacca ggctggtgtc gaggaccagc tcaaggatgt gaccttcagc       420
     gagcataaag tgaacggcaa gagcaagggt caagcattcg ttgagtttac cacagcgcgg       480
     gctgcgaccg caactaggca ccacattgaa agaaatgata ctcccgcgcg cagacacacc       540
     gtgcaataca ccacccccca ccaaaacccg ttccgaactc tccctaagga tgctccgatg       600
     cgcaatgctg gcggtcgcgg cggcggtgct gcccacccca ctggtggcaa ctacggcatg       660
     aacaacgctg gtggcggatt ccgcggccgt ggcagcggat tcaaccgcgg tatgggtcac       720
     atgaacaact ttaacaaccg caacaacttc aaccccatgg gcggattcca aggtggcggc       780
     cccaacccca tgatgggtgg cttccagggt gctccgatgg gtggcatgcc aaactacggt       840
     tttaacaatc gcggcaacat gatgggtggt ggtatgcgtg gtaacatgcg cggcggtcgt       900
     ggtgtaggca tgggtggtgg tccgaacatg atgggtatgc ctgctatgac tccccccatg       960
     ggtggcatgg gcatgaaccc gatggctggt atgaatccta tgatgggcgg cggtatggca      1020
     ggtggcatgg gaggcaacat gccaatgcaa ggacaacaag gtttccaggg ccccaacccg      1080
     ggattcaacc agggctacta caaccctaac aacccaaaca accccaacaa ccccaacaat      1140
     cagaatcagg ccagcggcag cggcagcggc tccgacggag gttcctggaa ccctcacggc      1200
     gcgaagcgaa gccgtcaaga ctaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page