(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE282

PENCW_16.PE282       Location/Qualifiers
FT   CDS_pept        join(complement(648841..649144),complement(648680..648778),
FT                   complement(648247..648623),complement(647807..648172),
FT                   complement(646981..647746),complement(646678..646877))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128983"
FT                   /orf_name="Pc20g02820"
FT                   /product="Pc20g02820 protein"
FT                   /protein_id="CAP85611.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001831AC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET7"
FT                   /transl_table=1
FT                   /translation="MNDITQNQPVTEVGTYLCTISIHGSLLISTTTIQNMSSRTPDDGT
FT                   ESSRGSEGIWHPAHEWLENDELDTDYHPALEPSEHDGAWEDDIPNEDQQMGSGVASENT
FT                   HINIGNIQIELTADDSESEDTDDLNEGHTRVPASRLFELLASSGLQHILQANGWPTAME
FT                   EEQETLEDEDDELSDEDFMPIFRNRLRARRSTETLKLPPVPNPEGKKLMSEGHFGTDQF
FT                   YGDRLRQRKKFLATSLMWRELGIDTDGVRKRAGQSISQGLIPSSIADKIIHYDTRSYSG
FT                   QFSDDGNFFFCCAQDFKVRMYDTSNPYDWKYYKTVDYPFGQWTITDATLSPDNRFLVYS
FT                   SIRSQAYMASTDPEDNSDPTVLDLSTPPGQRRRRSWGSSHFGIWSLRFSGDGREVVAGT
FT                   SEDSVIVYDLETRQPVLNLRERHQHHVNAVCYGDTSSPHILYSGSDDTTIRVWDRRSMG
FT                   DGREAGAFMGHTEGLTYVDSKGDGRYVLSNSKDQTMKLWDLRKMMTSADIENIDPFDYS
FT                   TGFDYRFEQYPDQYRRNAKNDCSVVTYRGHRVLKTLIRCHFSPPGSTNSRYVYSGSEDG
FT                   KVYVYNLDATLAGTIDVGQATFNSRPRDPDAYATAYEMSGEMLWRTCVRDASWHPNAPV
FT                   LAVHSWNAGAAKDEGDPPAGKSYDDRLRHIPEFDQYRESAPHGRPRRPLRSRPVRRWVG
FT                   DEEAEDAIW"
     atgaatgaca taacccaaaa ccagcccgtg accgaggtcg ggacttatct atgtacgata        60
     agcatccatg gatctctcct catctccact acaacaatac aaaatatgag ttcaaggaca       120
     cctgatgatg ggactgaatc ttcaaggggc tcagaaggga tctggcatcc tgcccatgaa       180
     tggctagaaa acgacgagct ggatacggac tatcaccccg cgttggagcc ctccgagcac       240
     gatggcgcat gggaggacga catacccaat gaagatcagc aaatgggctc gggggttgca       300
     agtgaaaata cgcacatcaa catcggaaat atccaaatcg aacttactgc ggacgattca       360
     gagagtgagg acacagacga tctaaatgag gggcacacgc gcgtgccggc ttcccgatta       420
     ttcgagttgc ttgcatcaag tggtttacaa catatcctcc aagccaatgg ttggccaacc       480
     gccatggaag aagagcagga gacgctggaa gatgaagacg atgagttaag cgacgaagat       540
     ttcatgccca tattccgaaa tcgcctccga gccagacgat ccacagaaac ccttaaactg       600
     ccaccagtgc ctaacccgga gggcaagaag ttgatgagcg aaggtcattt cggaactgac       660
     caattctacg gcgaccggct caggcagcgg aagaagtttc tggcgacaag tcttatgtgg       720
     cgagaactag gcattgatac tgatggagtg cgaaaaagag ccggtcaatc tatctcccag       780
     ggcctcattc caagttcgat tgcagacaag atcattcact atgatacgcg aagttattca       840
     ggccagttct cagatgatgg gaatttcttt ttctgttgcg cacaagactt caaggttcgg       900
     atgtacgaca catccaatcc gtacgattgg aagtactaca aaaccgtcga ttatccgttc       960
     ggccagtgga ctatcaccga tgcgactctg agccccgaca atcgctttct cgtttacagt      1020
     tcaatacgaa gtcaggcata tatggctagc acggacccag aggacaattc ggatcccact      1080
     gttttagatc tatcaactcc accgggacaa aggagaaggc ggagctgggg tagttcacac      1140
     ttcgggattt ggtctcttcg attctctggg gatggacgtg aggtggtcgc cggcacatca      1200
     gaagactcgg ttatcgttta tgatttagaa acacgacagc ctgttttgaa tctacgagaa      1260
     cggcaccaac atcatgtcaa tgctgtgtgt tacggcgaca catcatcccc gcacatcctg      1320
     tactccggat cggatgacac gacaattagg gtttgggaca ggcggtcaat gggcgatggg      1380
     cgtgaagccg gtgcctttat gggccacacc gaaggactaa cgtatgttga cagcaagggc      1440
     gacggccgat acgtcttgtc aaatagcaaa gaccaaacaa tgaagctttg ggatctacgg      1500
     aagatgatga catctgccga tatcgaaaac atcgacccat tcgactactc aaccggcttc      1560
     gattaccgct tcgagcaata tccagaccag taccgcagaa atgccaagaa tgactgctcc      1620
     gttgttacat atcggggcca tcgagtcctg aaaacattga ttcgctgcca cttctcgcca      1680
     cctggaagca ccaattcacg ttatgtttac agtgggagtg aagacggcaa ggtttatgtg      1740
     tacaacctgg atgccacact agctggcacc attgacgttg gccaagcgac attcaactca      1800
     cgaccgcgtg atccagatgc ctatgctaca gcctatgaga tgagtgggga gatgctgtgg      1860
     aggacttgcg ttcgcgatgc aagctggcac cccaatgcgc cagtactagc agtgcattct      1920
     tggaatgccg gtgctgctaa agacgaaggg gatccaccag ctgggaagag ttacgacgac      1980
     agactacgac acattcctga gtttgaccaa taccgcgaga gtgcaccgca tggtcgaccc      2040
     cggcgtccat tgcgcagtcg gcctgttcgt cgatgggttg gtgacgagga agcagaggac      2100
     gcaatatggt aa                                                          2112
//

If you have problems or comments...

PBIL Back to PBIL home page