(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE283

PENCW_16.PE283       Location/Qualifiers
FT   CDS_pept        join(complement(650480..650531),complement(650317..650414),
FT                   complement(650033..650236),complement(649890..649928),
FT                   complement(649689..649763),complement(649471..649644))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948846"
FT                   /orf_name="Pc20g02830"
FT                   /product="Putative uncharacterized protein Pc20g02830 "
FT                   /protein_id="CAP85612.1"
FT                   /db_xref="UniParc:UPI0001831AC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF44"
FT                   /transl_table=1
FT                   /translation="MRLSNHLILFSTHLALSIAAGCGDADACVGTEICTTATFTTPTAT
FT                   TITTCRIVSPAVRAKSAAPHTVRPLNVDRLTQTGRTARRIMAHVWQMRTAATETSVWTD
FT                   FVLDLESRLSRELVVNVALELPNCPNYLSLYYPSGRTTIHCNGEPKPIPIERNIHIQKP
FT                   EIRLLQASVFQHIMRSSWFLKGQLSSTPYGNNAIPSHQSHRAGAGNTKWV"
     atgcgtcttt ccaaccattt gattctgttc tctactcacc ttgccctaag catcgcagct        60
     gggtgcggcg atgctgatgc ctgcgttgga actgagatct gcaccaccgc tactttcaca       120
     actccaactg caactaccat cacgacctgt cggattgtga gtccggcggt tcgggccaaa       180
     tctgctgctc cacatactgt gcggccacta aatgtcgatc gactgaccca gactggccga       240
     actgcaagga ggataatggc ccatgtctgg cagatgagaa ctgctgctac ggaaacaagt       300
     gtgtggacgg actttgtact cgatcttgag tccaggttga gtagagaact tgtagtaaat       360
     gtagccctgg agttaccaaa ttgccctaat tatttgtctc tttattaccc atcgggaagg       420
     actacaatcc attgcaatgg ggagcctaaa ccgataccta tcgaaaggaa catacatatt       480
     caaaagccag agattcgttt actgcaggct tctgttttcc agcatataat gcgctcatct       540
     tggttcttga aaggtcaatt gagttctaca ccttatggaa ataatgcaat tccgtcacac       600
     caaagccaca gggctggagc gggtaacacc aagtgggtgt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page