(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE284

PENCW_16.PE284       Location/Qualifiers
FT   CDS_pept        651517..652554
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824630"
FT                   /orf_name="Pc20g02840"
FT                   /product="Pc20g02840 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP85613.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI0001831AC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF45"
FT                   /transl_table=1
FT                   /translation="MATKTLMASCQCKNFQFTVAVPTECFPLNIHLCHCSICRYTHGAP
FT                   CSFHAPLPVGVEPQFIAPSSLNKLTSYQHPASTATGYFCSTCGCQIGGADGQWVITPAI
FT                   FDANREDEGIWKFNAHMLPTSAPDGGLAAVFSLIDGHRMEIENLGLSPQAIAGSDSQPP
FT                   DPESKELLAQCHCGGVSFTIARPSEEFIASPRSKGWISPLDKSKWLASMDLCDDCRLVT
FT                   GTHVISWMFVSIDHITPRLPKDLLIGSAKGYRSSKDVLRVFCGTCGATVFYHCDGRPEI
FT                   VDVAMGILRAPEGAMAENWSVWRAGRASFPENGMRYHAGFSRALIEGMQRWGAERGHPQ
FT                   DFEIA"
     atggctacca agacattaat ggcttcgtgc caatgcaaga atttccagtt cactgtcgcc        60
     gttccaaccg aatgttttcc cttgaacata cacttatgtc actgtagcat atgtcgttac       120
     acccacggcg caccatgcag ctttcacgca ccactaccag ttggtgtgga gcctcaattt       180
     attgcaccat caagtctcaa caaactgact agttatcaac acccagcatc aacagcgacg       240
     ggctatttct gcagcacttg tggctgccag attggaggag ctgatggtca atgggtaatc       300
     actcccgcaa tcttcgatgc caatagagag gatgagggca tttggaagtt caacgcccat       360
     atgcttccga cctctgcacc ggatggagga ctagcagctg tgttttcgct cattgacgga       420
     catcgaatgg agatcgaaaa tctaggtctg tctccgcagg ctatagccgg gagcgattct       480
     cagccacctg atcccgaaag caaagagctc ctagcgcagt gtcattgcgg tggagtctct       540
     ttcactattg cccgccctag cgaggaattc atcgcaagtc ctcgaagtaa aggatggatt       600
     tcacccttgg acaagagcaa gtggcttgca tctatggatc tctgtgacga ctgtcgattg       660
     gttactggca cacatgttat tagttggatg tttgtatcga ttgaccatat cacgccgcgt       720
     ctccccaagg acttattgat cgggtcagcg aagggctatc gctcctcgaa agatgtactc       780
     cgggtattct gcggcacttg tggtgcaact gtcttttacc attgcgacgg gcgaccggag       840
     attgtagatg tggcgatggg aattctacgc gcgcctgaag gcgctatggc tgagaactgg       900
     agcgtgtgga gagctggccg ggcatcattt cccgagaacg gaatgcgata tcacgccgga       960
     tttagtcgtg cgctgatcga ggggatgcag cgatgggggg ctgaacgggg gcatcctcaa      1020
     gattttgaaa tagcatag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page