(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE285

PENCW_16.PE285       Location/Qualifiers
FT   CDS_pept        join(653177..653254,653433..653754,653818..653846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824631"
FT                   /orf_name="Pc20g02850"
FT                   /product="Pc20g02850 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP85614.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0001831AC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF46"
FT                   /transl_table=1
FT                   /translation="MQSVPESRQQSFEEIYGPPENFLEIEVRNPQTHGTSRNMYTSYEI
FT                   VCRTNIPAFKLKHSVVRRRYSDFEYFRDILERESTRVTIPPLPGKVFTNRFSDDVIEHR
FT                   REGLQRFLQIVAGHPLLQTGSKVLASFIQDPNWDRNAW"
     atgcagtccg tcccagaatc gcgacagcaa tccttcgagg agatctacgg accaccggag        60
     aacttcctcg agatagaagt ccgcaacccc cagacccacg gcacatctcg caacatgtac       120
     acgtcgtacg agattgtgtg ccggaccaac atccccgcct tcaaattgaa acactccgtc       180
     gtgcgccgcc ggtactccga tttcgagtat ttccgcgata tcctggagcg cgagagcacg       240
     cgcgtcacta tacccccgct ccccgggaag gttttcacca accggttcag cgacgacgtc       300
     atcgagcatc gccgcgaggg tctgcagcgc ttcctgcaga tcgtcgctgg acaccctctt       360
     ctgcagacgg ggagtaaggt gcttgctagt ttcatacaag atcctaactg ggaccgcaat       420
     gcatggtag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page