(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE286

PENCW_16.PE286       Location/Qualifiers
FT   CDS_pept        join(complement(655642..656690),complement(655553..655582),
FT                   complement(654576..655497))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194447" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824632"
FT                   /orf_name="Pc20g02860"
FT                   /product="Pc20g02860 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85615.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI0001831AC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF47"
FT                   /transl_table=1
FT                   /translation="MESSSALRPLDESLLRELPQLSLRIAPLREPVSSRTLSVPSPLEP
FT                   NASGARDSNNISNSSSNSGKIQANAKEGLPTVTEFLNAARIRKTELSADSQSNVERPPR
FT                   PILPAFVNLRALEKFPFSSSFDDDALQGPRKRRRRDPQPDSFSEHLQLPIPQAQKEQRP
FT                   PPFGPFAILNGLNEPPPNAALLPPIEAGSNISQLLNKPSRGDAAADSGTSVSAHAAISD
FT                   GQPAERRDTRLEDILRTSLNADGDHDQNDNAENVQSTNPVDPDEIALAVREAEKLKDSK
FT                   ESPLPPAADAPMSPKTRGRSRKNLRKWSEEETTNLLRGVIKCGIGNWTAILAQPELKFN
FT                   QRTASNLKDRFRVLCPWAYSASDPDLAAKQLHDTLANSLLKAKAEGSDESPSKLHLSHL
FT                   IPSNFEPNFGAGSPACNPQEPLISSTAPDTDPRGSTTAQSQSPSSGNSTPALSSKSRTT
FT                   LASLGIPEPHVSRTKRRSRRPFTAAEDEALLKGYAVHGFQWTLIQQDSRLNLSHRKATD
FT                   LRDRFRTKFPHAYRDGGSVSGKALTSQNQAQESAVGTSTPRPHAGTEQSPSKAYAMTPT
FT                   QTPATTPRTSVSRSRHAATPSQSNPAQIDPALLPPPPQGFLEHSMYLPPAAAAGALSFS
FT                   LDDGPGTGASSAVETPWEDNTLAPMIWDELT"
     atggaatctt cgagtgcctt acggcctctt gacgaatcac tactccgcga actgcctcaa        60
     ctctctctcc gtatcgcccc tctacgagaa ccagtatcat cacgaaccct aagcgtccca       120
     tcgcccctag aacctaatgc cagtggagca agggactcga ataatatttc caattcaagc       180
     agcaatagcg gaaagatcca ggcaaatgca aaggaaggcc tgccgacagt tacggaattc       240
     ctgaacgctg ctcgcatcag gaaaaccgaa ctctcggcag actctcagtc aaatgtggag       300
     cgtcccccaa ggccgatact tcctgctttt gtgaatcttc gtgccctgga aaagtttccg       360
     ttctcgtcat ctttcgatga tgatgccctc caagggcccc gcaagcgtcg acgtcgagac       420
     ccccagcctg attcattcag cgagcatcta cagttaccta tcccccaggc ccagaaggag       480
     cagcggcctc ctccatttgg gccatttgct attttaaatg gattgaatga gcccccgccc       540
     aatgctgcac ttcttccacc gatcgaggct gggtctaata tctcccagct attgaataag       600
     ccctcccgag gcgatgctgc tgctgactct gggacgtcag tttcggctca tgccgcgata       660
     tcagatggcc agcctgcgga aagacgagat actagacttg aggacatcct cagaacgtct       720
     ctcaatgcgg atggagacca cgaccaaaat gataatgctg aaaatgttca aagcactaac       780
     ccagtggatc cagatgagat tgccctggcc gttcgtgaag cagaaaagct caaggatagt       840
     aaggaatcgc cactccctcc tgcagcagat gcgccaatgt ctcctaaaac ccgtggccgg       900
     tcccgtaaaa acctgagaaa gtggtccgaa gaagagacga ctaatctact tcggggcgtg       960
     attaaatgcg gcattggcaa ctggactgct attcttgctc aaccggaatt gaagttcaat      1020
     cagcgaactg cctcaaattt gaaagacaga ttccgagtct tatgtccatg ggcatacagc      1080
     gcatccgatc ccgacttggc tgcaaaacaa ctacatgaca ctctcgctaa cagcctactc      1140
     aaagccaaag cagagggctc tgatgaatca cccagcaaac tccacctctc ccatctaata      1200
     ccctccaact tcgaaccaaa ctttggagca ggaagcccgg cttgcaatcc tcaagaacca      1260
     ttgatctcga gtaccgcacc cgacacagat cccaggggta gtactactgc ccaatcacag      1320
     tcgccctcat caggaaacag cacacccgct ctctcaagca agtcccgcac aacgctcgca      1380
     tctctcggaa tccccgaacc acatgtctca agaaccaaac gtcgctctcg gcgacccttc      1440
     acagccgccg aggacgaagc cctacttaaa ggctacgcag tccacggctt tcaatggacc      1500
     ctaatccagc aagattcacg cttgaaccta agtcaccgca aagcgacaga cctccgcgac      1560
     cgcttcagaa ccaagttccc acacgcctat cgcgacggcg gttctgtgag cggaaaagcc      1620
     cttaccagcc aaaaccaggc ccaagagtcc gctgtaggca cgtcgacccc ccgtccccat      1680
     gctggcaccg aacaatctcc gagcaaggct tatgccatga ctccgactca gactccggct      1740
     accactcctc gcacctcggt gtcgaggagt cgtcacgctg ctactccctc ccagtccaat      1800
     cccgcccaga ttgatcctgc gctgttgcct ccgcctccgc agggcttttt ggagcattcg      1860
     atgtatcttc ctcccgctgc agctgcaggt gcgctttctt tctctttgga tgatggccct      1920
     gggactggtg cttcttctgc ggtagagaca ccgtgggaag ataataccct cgctcctatg      1980
     atatgggatg aattgaccta g                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page