(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE287

PENCW_16.PE287       Location/Qualifiers
FT   CDS_pept        join(657129..657190,657259..657667)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194436" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824633"
FT                   /orf_name="Pc20g02870"
FT                   /product="Pc20g02870 protein"
FT                   /protein_id="CAP85616.1"
FT                   /db_xref="UniParc:UPI0001831AC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF48"
FT                   /transl_table=1
FT                   /translation="MPTIFPTWPHILFGVLEPISLALGSVFPLYDLEGFIAGQTPTIAA
FT                   PATLHPSSVALAYQLGNVYSLLFLVGVGVCHATTEPRVLRNYLIGLAIADVGHVYATYL
FT                   AMGWDAFADVGAWNALTWGNIGITMFLFVNRIAYFLGIFGYAKAPKAAAKRE"
     atgcccacta ttttcccaac atggccacac atcctatttg gcgtccttga acctatctca        60
     ctggccctcg gcagtgtctt ccccctctac gacctggaag gctttattgc cgggcagaca       120
     cccaccatcg cagccccagc caccttacac ccaagcagcg tcgcactcgc ctaccaactc       180
     ggcaatgtct attccctcct cttcctagtc ggtgtcggtg tctgccacgc cacaacagag       240
     ccaagggtgc tgcgcaacta tctaattgga ctggccatcg ccgatgtagg ccatgtctac       300
     gccacgtact tggcgatggg ctgggacgcg tttgcggacg ttggggcatg gaacgctttg       360
     acctggggta acattgggat cacgatgttc ctgttcgtta ataggatcgc ttatttcttg       420
     ggcatttttg gttatgcgaa ggcgcctaag gcggctgcaa aacgggagtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page