(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE288

PENCW_16.PE288       Location/Qualifiers
FT   CDS_pept        join(complement(659356..659961),complement(658807..659292),
FT                   complement(658434..658736))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948847"
FT                   /orf_name="Pc20g02880"
FT                   /product="Pc20g02880 protein"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85617.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="UniParc:UPI0001831AC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF49"
FT                   /transl_table=1
FT                   /translation="MSAQSSIAASDWGHSYPSIFQLNLEIPAFFMPYRWWEDEATTVFW
FT                   AFDIQGISRVIQFGLFRDENFPRTSLCARNVDTIDTFLMALSEPHEYQLLGNLSHIQRV
FT                   EEILRRSSISPFQAIPWSWLPPQPSPTLDAREIAAAIEAESHFHFKQVAFEELVRAALG
FT                   YNAIFVDWFLQQHEALYIILRDHLGAYPEDIPLYTEVGKHLRSRSPFAYRALVQCLIAV
FT                   RPGGNRDVTKPTAGFEFIAGPIQALFKEQPGRLIAMLKMLSVLTIRFRRKYVHAPTMDW
FT                   RTPFDTSIPFLDDYLESTSPTDLARSMRGLDEHHFAELTRQSLIAEDAVVGQLKVQWRE
FT                   LSVSVWECCAALPDLIPYLQECAQTLLTTRNYHSFTAIIKGLHTYSILKTRPGNTGTQG
FT                   NVVTLETLFPQEILSLMSPAQNYAAYRQHYQKFPGIPFLIPHIRDHKENGESVLQPVFQ
FT                   YLQSTQ"
     atgtcggctc aatctagcat tgcggcttcg gactggggac attcttaccc atcaatcttc        60
     caactcaact tggaaatccc cgcctttttc atgccttatc gctggtggga agacgaggcc       120
     acaactgtgt tctgggcgtt cgatatccaa ggaattagcc gtgtgatcca attcgggctc       180
     tttcgcgacg aaaacttccc gaggacgtcg ctttgcgctc gcaatgtgga cacaattgac       240
     accttcttga tggcgctgtc cgagccccac gagtaccagc tccttgggaa tctctctcat       300
     atacagaggg tggaggagat cctacgccgg tcgagtatat ctcccttcca ggcgattcct       360
     tggagttggc tcccgcctca gccgagccct actctagatg cgcgggaaat cgctgccgca       420
     attgaggccg agagccattt ccactttaag caggttgcct tcgaagagct tgtacgggct       480
     gccctcggat acaatgctat ctttgtcgac tggtttctac agcagcacga ggctctttat       540
     attattctcc gggatcatct aggcgcctat ccggaggaca ttcctctgta cacagaagtg       600
     ggaaagcatc ttcggtcgcg gagtccattc gcataccgag cgttagtcca gtgcctcata       660
     gctgtgcgac ctgggggaaa tcgtgacgtg actaaaccca ccgctgggtt tgaattcatc       720
     gcaggcccta tacaggcctt attcaaggag cagccaggaa ggcttattgc tatgcttaag       780
     atgttaagtg ttttgacaat ccgatttcgc cgaaagtatg tccatgctcc taccatggac       840
     tggaggaccc catttgatac ctctattcct ttcctggacg attatctcga gtcgacatct       900
     ccaacggact tggcccgcag catgagaggc ctagacgagc accactttgc cgagttaacc       960
     cggcaaagcc taatagcaga ggatgcagtc gtggggcaat tgaaggttca gtggcgcgaa      1020
     ctcagcgttt ctgtctggga atgctgcgct gcacttccag acctgatccc atatctacaa      1080
     gaatgtgcac agacgctttt aacaacacgt aattatcatt ctttcacggc tatcatcaaa      1140
     ggcctgcaca cctacagcat cttgaaaacg cgccctggca acacaggcac ccaaggaaac      1200
     gtggttaccc tcgagactct gtttccgcag gaaatccttt ccctcatgag cccagctcag      1260
     aactatgccg cctatcgcca gcactaccaa aaattccccg gcattccttt cctgatccct      1320
     cacatccgtg atcacaagga aaacggcgaa tccgtcctcc agccagtttt ccagtatctg      1380
     caaagcaccc agtaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page