(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE290

PENCW_16.PE290       Location/Qualifiers
FT   CDS_pept        join(complement(665360..665370),complement(665076..665213),
FT                   complement(664723..665007),complement(664296..664590),
FT                   complement(664188..664241))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948848"
FT                   /orf_name="Pc20g02900"
FT                   /product="Pc20g02900 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85619.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="UniParc:UPI0001831AC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF51"
FT                   /transl_table=1
FT                   /translation="MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIV
FT                   FIRNRLKYALNGREVKAIMMQRLVKVDGKVRTDTTYPAGFMDVISLEKTGEHFRLIYDT
FT                   KGRFTVHRIQAEEAEYKLCKVKRVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTVKVDI
FT                   ATGKILDFVKFDSGVVIMATGGRNMGRVGVITHRERHDGGFNIVHVRDALDNQFATRES
FT                   NVFVIGQDKPWVSLPKGKGVKLSIAEERDRRRAHDLAN"
     atgcgcggcc ccggaaagca ccagaagcgc ctcagtgcgc cctcgcactg gctcttggac        60
     aaaatgtccg gaacctacgc gcccaaggcc tcccccggtc ctcacaagct ccgggactgc       120
     cttcccctga ttgtcttcat ccgtaaccgt ctcaagtacg ccctgaacgg tcgcgaggtc       180
     aaggccatca tgatgcagcg tctggtcaag gtcgacggca aggtccgcac cgacaccacc       240
     taccccgctg gtttcatgga cgtcatctcc ctcgagaaga ccggcgagca cttccgtctc       300
     atctacgata ccaagggccg tttcaccgtc caccgcatcc aggctgagga ggctgagtac       360
     aagctctgca aggtcaagcg tgttcagctc ggcaagggcg ggatcccatt cttggttacg       420
     cacgatgcgc gaaccatccg ctaccccgac cctgccatca aggtcaacga caccgtcaag       480
     gttgacattg ccactggcaa gatcctcgac ttcgtcaagt tcgactccgg tgttgtcatc       540
     atggccactg gtggtcgcaa catgggtcgt gttggtgtca tcactcaccg tgagcgtcac       600
     gatggtggtt tcaacatcgt ccacgttcgc gatgctcttg acaaccagtt cgctacccgt       660
     gagtccaacg tcttcgtcat tggacaggac aagccctggg tttccctccc caagggtaag       720
     ggtgtcaagc tctccattgc tgaggagcgt gaccgccgcc gtgcccacga ccttgccaac       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page