(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE291

PENCW_16.PE291       Location/Qualifiers
FT   CDS_pept        join(complement(666855..666885),complement(666539..666796),
FT                   complement(665672..666477))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977848"
FT                   /orf_name="Pc20g02910"
FT                   /product="Pc20g02910 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85620.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831ACA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF52"
FT                   /transl_table=1
FT                   /translation="MAPSFPKKKCGVLGATGSVGQRFILLLADHPFLELHAVGASERSA
FT                   NKKYKDAVNWKQSKPMSEKLSNLVMRDCKPEQFSDCDLVFSGLNSDVAGETEMAFIKAE
FT                   IPVFSNAKNFRKDPMVPLVVPTVNPQHLDLIPHQREQYGLKKGFLVCNSNCAVIGIVIP
FT                   FAALQAKFGPVEEVEVFTEQAVSGAGYPGVPTMDILDNVIPYISGEEDKLENEAQKILG
FT                   SLNASATGFDEQTGLRIGATCTRVGVTDGHMAFVSLRFKNRQTPTAEQVKEALREYKSE
FT                   AQKLGAPSAPEPAIKVFDAPDRPQPRLDRDISGGYTVSVGRVREGAPGGHFDIRFAALS
FT                   HNTVIGAAGSSILNAEVAVIKGYI"
     atggctcctt cattcccaaa gaagaagtgc ggtgttctcg gtgccactgg ctccgtgggc        60
     cagcgcttta tcctgttgct ggcagaccac cccttccttg agcttcacgc tgtgggtgct       120
     tctgaacgtt cagccaacaa gaaatacaag gatgccgtga actggaagca gtctaaaccc       180
     atgtccgaga agctcagcaa cttggtgatg cgtgactgca agcctgagca gttctcggat       240
     tgtgaccttg tcttctctgg actgaacagc gatgttgctg gcgagactga aatggcattc       300
     attaaggctg agatccctgt tttctcaaat gcgaagaact tccgcaagga ccccatggtg       360
     cctctggtcg ttccaactgt gaacccccaa catctggatc tgattcctca ccagcgcgag       420
     cagtacggtc tcaagaaggg cttcctggtc tgcaactcca actgcgctgt tattggcatc       480
     gtcattccct tcgcagctct ccaggccaag tttggccccg tcgaggaagt cgaggttttc       540
     accgagcagg ccgtttctgg agcaggctac cccggtgtac ctaccatgga catcctggac       600
     aacgtcatcc cctacatcag cggcgaggaa gacaagcttg agaacgaagc ccagaagatt       660
     ctgggttcgt tgaatgccag cgccaccggt ttcgacgagc agactggact ccgcatcggt       720
     gccacttgca cccgtgttgg tgtcactgac ggccacatgg cattcgtttc cttgcgtttc       780
     aagaaccgcc agacccccac cgccgagcag gtcaaggagg ctctgcggga gtacaagtcc       840
     gaggcacaga agttgggtgc tccttccgca ccagagcccg cgattaaggt gttcgatgcg       900
     cccgaccgtc cccagccccg tctggaccgc gacatctccg gtggatacac agtaagtgtt       960
     ggtcgggttc gtgaaggtgc cccaggtggt cactttgata tccgattcgc tgctctctcc      1020
     cacaacactg tcattggagc tgctgggtca tccatcctca acgccgaggt tgctgttatc      1080
     aagggctata tttaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page