(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE296

PENCW_16.PE296       Location/Qualifiers
FT   CDS_pept        join(complement(684656..684890),complement(679747..684605))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948850"
FT                   /orf_name="Pc20g02960"
FT                   /product="Pc20g02960 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAP85625.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI0001831B9B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF56"
FT                   /transl_table=1
FT                   /translation="MEPFRVRLNCIDHYQATASELDPPLLFRDEVSEKDFKPKVPVIRI
FT                   FGATETGQRVCVHVHGAFPYLYIEYNGSLAPEDVNSAIRTLHLSIDHALAVSFRRNAYD
FT                   RRTAFVAHITLVKGVPFYGYHVGWRFFFKIYLLNPFHMTRLVDLLHQGAVMKRPLQPYE
FT                   AHVQYIPQWMCDYNLYGCAIMSCSQAKFRAPVPEYFELSNLAHRWHDRSILPESILDHP
FT                   ALQKQSHCALEVDVCVQDILNRLDVKERPLHHDFTELLKPVAVNERLVPSVAGLWQDET
FT                   RRRKKRMGLTDPGSTPFGPEELVSMSADPRDQSKGGWIHEEEFREMASQLAANEKQADG
FT                   GKDTSFGTFLDTDDQAKYVKTALDSTEDFFPGKISTSTFDSSRSQEPAEQKLSEISVDE
FT                   GLALSSQTDGQYYSDSDQGGHSLEGIIEHEPETKQDPLGDSFYDEIFDEMPFLDVAAPA
FT                   ESAETNCPEAAMDGGYKEGDYVAQERRPRDQSQNKSVAPKRQRSETLDCHHSPTKRARH
FT                   IAEHGLSDGPLESPNTRKHQQDDKPKNVSFDSNLDSHAETPSSESKSSSQRTVRPKAHS
FT                   YTSGLKFPVVKDPNDPLTILRYSQDEATSSRKDPESSQPLLNSFPSGSATELSGKTSET
FT                   QSSSELHSSATVMGPVSLDPHLSQTVKSIRQSFSFAPNTSLHCFKFASPTFSEVSSSIN
FT                   EHGRPSVVYQKAFYSDEADVPERPREYGGREFRLESNTIHYLPDFDPTAEAPAMFGEQT
FT                   PTAHDRDQQEKVDQQLREWCTSKVWEFAPVPPSRSEVIRWFEELEASQEPDRKAAQPIP
FT                   PEMKSNLLSQIEGPTQKNAHGFKYSQNGVSTSVEHQAQHMSTMSLEVHVNTRGTLMPNP
FT                   EEDEITSLFWCIQSEDEDIEVNSHLPGVHVGMVYHGEGERPEAKISKALTIDVEHEPTE
FT                   LDLINRLIDIVRYYDPDIITGYEVHNASWGYVIERARKKYDFDICEELSRTKSQSNGRF
FT                   GKEADQWGFNHSSSIRITGRHMFNIWRAMKSELNLLQYTMENVVFHVLHRRIPHYSPKH
FT                   LTQWHQSGRPRNILKVVQYFTSRVQMNLEILEANELTPRTSEQARLLGIDFASVITRGS
FT                   QFKVESLMFRIAKPENFLLVSPSRKQVGQQNALECLPLVMEPQSDFYTSPLLVLDFQSL
FT                   YPSVMIAYNYCYSTFLGRAMHWRGRDKMGFIDYKRQPRILELLKDKINIAPNGMMYAKQ
FT                   EARQSLLAKMLSEILETRVMVKNGMKADKDDKVLQRLLNNRQLALKLIANVTYGYTSAS
FT                   FSGRMPCSEIADSIVQTGRETLEKAIAFIHSVERWGAEVVYGDTDSLFVYLKGRTRDQA
FT                   FDIGEEIAQAVTDLNPRPVKLKFEKVYHPCVLLAKKRYVGFKYEHRNQKEPEFDAKGIE
FT                   TVRRDGTPAEQKIEEKALKTLFRTADLSQVKSYFQRQCAKIMQGRISIQDFCFAREVRL
FT                   GTYSDRHLPAGAVISTKRMLEDPRSEPQTGERVPYVVVTGAPGARLVDRCVAPQTLLHD
FT                   AQLELDAEYYITKNIIPPLERIFNLVGANVRQWYDEMPKVQRIRRVEGSALARPNSVGG
FT                   ASRKTLESYMRSSSCVVCRSRLSDAAVPVCGDCLQKPHLTLLDVVSRLQRAEKRVVDLE
FT                   AICRSCMGVSPGDEVSCDSLDCPIFYSRARDAANWRHSKAVLEPVVELLERKGDEGLDW
FT                   "
     atggagccat tccgtgtgcg tctcaactgt atcgatcatt accaggcgac cgcgtcggag        60
     ttggatccgc cactactttt tcgtgatgag gtctcggaga aggattttaa gcccaaggtg       120
     cctgtgattc gaatattcgg agccaccgag actggacaga gggtttgtgt acatgtccat       180
     ggtgcatttc cataccttta catcgaatac aacgggtcct tggcgccgga agatgtgaat       240
     tcggcgatcc gaaccctcca tctttcaatc gatcatgccc tggcggtcag cttccgccga       300
     aatgcatatg accgtcggac agcatttgtg gcgcacatca ccttggtgaa aggagtccca       360
     ttctatggat accatgtggg gtggaggttt ttcttcaaaa tttatctctt aaaccccttc       420
     catatgactc gcctggtaga tcttctgcac cagggagctg tgatgaaacg tccgcttcaa       480
     ccctacgagg cacacgtgca atacatcccg caatggatgt gcgactacaa tttgtacgga       540
     tgtgcaatca tgagctgtag tcaagccaag ttccgagcac cggtacctga gtatttcgag       600
     ctcagcaatc tagcccatcg ctggcacgat cgttccattt tacccgagag catactcgat       660
     caccctgcat tacagaagca aagccattgc gcgctggagg ttgatgtctg tgttcaagat       720
     atcctgaacc gccttgatgt aaaggaacgg cctttacacc atgattttac ggagcttttg       780
     aaaccagttg cggttaacga gcggctcgtt cctagcgtgg ctggactgtg gcaggatgaa       840
     actcgcagac gcaaaaagag gatgggttta acagatcccg gaagcactcc gtttggacct       900
     gaagaattgg tttcaatgtc tgcggaccca agagatcagt cgaaaggtgg ttggatacac       960
     gaggaagaat ttcgtgagat ggcatctcag cttgctgcta atgagaaaca ggcggatggc      1020
     ggcaaagata cgtcatttgg gacattcttg gataccgatg atcaagccaa atatgtcaag      1080
     accgcgttgg atagtactga ggacttcttt cctggcaaaa tcagtacttc tacttttgat      1140
     agcagccgtt cccaggaacc agccgagcaa aaactatcgg aaatctcggt tgacgagggt      1200
     cttgctttgt cttctcaaac tgacggacaa tattactcgg attctgacca aggagggcac      1260
     tcattggaag ggataattga acacgagcct gaaacaaaac aggacccgct gggagacagc      1320
     ttctacgatg agatctttga cgaaatgcct ttcttagatg tggctgcacc tgcagagtct      1380
     gctgaaacca actgcccaga agcagctatg gatggtggct acaaagaagg ggattatgta      1440
     gcccaagaaa gaaggcccag agaccagagc caaaacaaaa gtgtagcgcc caaaagacaa      1500
     cgctccgaaa ccctcgattg ccatcattcg cctaccaaaa gagctagaca tatagccgaa      1560
     cacggcttgt ctgacgggcc tttggaatcg cccaacacgc ggaagcatca gcaagatgac      1620
     aaaccaaaaa atgtctcctt tgatagcaat ttggattctc acgcggaaac cccgtcctca      1680
     gaatcaaaat catcctcgca gaggacagtc cgtccaaagg cgcatagtta caccagcggc      1740
     ttgaaattcc cggtagtcaa ggacccgaat gaccctctga ccattttgcg ctacagtcaa      1800
     gatgaggcaa cttcttcgag aaaagacccc gagtcatccc agcccctctt gaattctttc      1860
     ccttcaggat ctgccacgga actgtcaggc aaaactagtg aaactcagag ctcgtcagag      1920
     ctacattcct cagcaacagt gatgggccca gtctctctcg atccacatct ctctcagact      1980
     gtgaaaagca ttcgtcagtc attcagtttt gcacccaaca cgtcattgca ttgcttcaaa      2040
     tttgccagcc caacgttcag cgaagtcagt tcatcaataa atgaacatgg gcgtccctca      2100
     gttgtatacc agaaagcatt ttacagcgac gaagcggatg tgcctgagcg accaagagaa      2160
     tatggcggca gagaatttcg gctggagagt aacaccatcc actatctacc cgatttcgac      2220
     ccaacggcag aggcacctgc aatgtttggt gagcagacac cgacagcaca tgaccgagat      2280
     cagcaagaaa aggttgacca gcaactccgt gaatggtgta cctccaaggt ctgggagttt      2340
     gctcctgttc cgccaagccg gtcagaagta atacggtggt ttgaagagtt agaagcctcg      2400
     caagagcctg accgaaaagc agcccaaccc atacctcctg agatgaaatc caacctcctc      2460
     tcgcagattg agggcccgac gcagaagaat gcacatggct tcaaatactc ccagaatggt      2520
     gtctccacca gtgtggaaca ccaagctcaa cacatgagca caatgagctt agaagtgcat      2580
     gtaaacacgc gtggaacctt gatgcccaac cccgaggagg acgagatcac ttccttgttc      2640
     tggtgcatcc aatccgaaga cgaggatatt gaagtcaata gtcatcttcc tggggttcat      2700
     gttgggatgg tttaccatgg cgaaggcgag aggccggagg ccaaaatctc caaagcattg      2760
     acaattgacg tcgagcatga gcctacggaa ctagacctga taaaccgact catagacatt      2820
     gtccggtact acgatccgga catcatcaca ggctacgaag tccacaacgc ttcgtgggga      2880
     tatgtgattg agcgagcgcg caagaagtac gactttgaca tctgcgagga gctttcaagg      2940
     accaaatccc agtccaatgg acgatttggg aaagaggcag atcagtgggg tttcaaccac      3000
     tcatcgtcca ttcgcatcac cgggcgacac atgttcaata tctggcgcgc tatgaaaagc      3060
     gagctgaacc tcctacaata cactatggag aacgtcgtct ttcatgtctt gcatcgccga      3120
     attcctcact attccccgaa acacctgaca caatggcatc aaagcggcag gcctcgcaat      3180
     attctcaaag tcgtgcaata tttcacctct cgcgtgcaaa tgaacctgga aatccttgag      3240
     gctaatgaat tgacgccaag gacaagcgag caggcgagac tgctgggcat tgatttcgcc      3300
     tccgtgatta cgcggggatc ccagttcaaa gtcgagtctc tcatgttccg aattgcgaag      3360
     ccagagaact tcctgctcgt ctcaccgagc agaaagcagg tcggacagca gaacgcatta      3420
     gaatgcttgc ccctggtcat ggaaccgcaa agtgactttt acactagccc acttctggtg      3480
     cttgatttcc agtcactgta cccgagtgtc atgatcgcgt acaactactg ctactcaacc      3540
     ttcctgggca gagcaatgca ctggcgtggg cgggataaga tggggttcat agattacaag      3600
     cgacagccca ggatactcga gttactgaaa gacaagatca acatcgcacc aaatggcatg      3660
     atgtacgcga agcaggaagc gcgtcagtcg ctgctagcca agatgctttc tgagattctt      3720
     gaaacccgcg tgatggtcaa aaacggcatg aaggccgaca aagacgacaa ggtcctgcag      3780
     cgacttctga acaacagaca gctagcgctc aagctgattg caaacgtcac atacggctac      3840
     acatccgcct cattctctgg gcgaatgcca tgttctgaga tcgccgacag tatcgtccag      3900
     accggacgag aaaccctcga aaaagccatc gcctttatcc actccgtcga acggtggggc      3960
     gccgaagtcg tctacggcga caccgacagc ctattcgtct acctaaaagg ccgcacccgc      4020
     gaccaagcct ttgacatcgg cgaagagatc gcccaagcag taacagacct aaacccacgg      4080
     ccagtcaaac tcaaatttga aaaagtctac cacccttgcg tcctgctcgc caaaaaacgc      4140
     tacgtaggct tcaaatacga gcaccgcaat caaaaagagc ccgaattcga cgcaaagggc      4200
     atcgaaaccg tccgtcgcga cggtacaccc gccgaacaaa aaatcgaaga aaaagcccta      4260
     aaaacactct tccgcaccgc agacctcagc caggtaaaat cctacttcca gcgccaatgc      4320
     gcaaagatca tgcaaggccg catctctatc caagatttct gcttcgcccg cgaagtccga      4380
     ctgggaacgt actctgaccg acacctgccc gctggcgcgg tgataagcac caagcgcatg      4440
     ctggaagatc cgcgctccga gccacagacc ggtgagcgcg tgccgtacgt tgttgttacc      4500
     ggtgcgccgg gggcgagact tgttgatcgt tgtgttgcgc cgcagacgct tctgcatgat      4560
     gcgcagctcg agcttgatgc ggagtactat atcacgaaga atattattcc gccgctggag      4620
     aggattttta atcttgtggg tgcgaatgtg cgtcagtggt atgatgagat gccgaaggtg      4680
     cagcgcattc ggcgagttga ggggtcggcg ctggcgaggc cgaattctgt tggtggggct      4740
     agtaggaaga ctcttgagtc ttatatgcgc tcatcgtcgt gtgttgtctg tcggtcgaga      4800
     ttgtctgatg ctgctgtgcc tgtgtgtggg gattgtctgc agaagccgca tcttacgttg      4860
     ctggatgttg tttcacggct gcagagggcg gaaaagagag tcgttgatct ggaagctatc      4920
     tgtcgctctt gtatgggtgt ttctcctggt gatgaggtta gctgtgatag tctcgattgc      4980
     cctatcttct actcgagggc tagagatgct gccaattgga gacactccaa agccgtgttg      5040
     gagcctgttg ttgaattgtt ggaacggaag ggagatgagg gattggattg gtag            5094
//

If you have problems or comments...

PBIL Back to PBIL home page