(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE298

PENCW_16.PE298       Location/Qualifiers
FT   CDS_pept        join(687130..687133,687208..687270,687421..687492,
FT                   687603..687742)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128986"
FT                   /orf_name="Pc20g02980"
FT                   /product="Pc20g02980 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85627.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniParc:UPI0001831B9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF58"
FT                   /transl_table=1
FT                   /translation="MTKGTSSFGKRHNKTHTLCRRCGKRSFHIQKSTCANCGYPAAKTR
FT                   KFNWGEKAKRRKTTGSGRMRSLRDVHRRFQNGFQTGTPKGARGPVTN"
     atgactaagg gtacctcgag cttcggaaag cgccacaaca agacgcacac tctgtgccgt        60
     cgttgtggca agcggtcttt ccacatccag aagtcgactt gtgccaactg cggctaccct       120
     gctgccaaga cccgcaagtt caactggggt gagaaggcta agcgccgcaa gaccaccggc       180
     tccggccgca tgcgctccct gcgcgatgtc caccgccgct tccagaacgg cttccagacc       240
     ggtaccccca agggtgcccg tggccccgtc accaactag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page