(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE299

PENCW_16.PE299       Location/Qualifiers
FT   CDS_pept        join(complement(689228..689488),complement(688638..689108),
FT                   complement(688260..688571))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194367" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948852"
FT                   /orf_name="Pc20g02990"
FT                   /product="Pc20g02990 protein"
FT                   /protein_id="CAP85628.1"
FT                   /db_xref="UniParc:UPI0001831B9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF59"
FT                   /transl_table=1
FT                   /translation="MPSQPPLPPLLAPYVSNLPDSSLTLVSSILGATSNWLILRFLHAA
FT                   LSSPSPNAAFGSDELHNGTKKKVVLVSFMRSYEFWRTEAKRLGLDLARLAEKQQFAFID
FT                   GLSELFYAPQPTATSPSISPAGLGSSPRTTLPMRSPPGAVPGRSPQPAGPTATGARGNA
FT                   TSKQAEPGIAKKLHFSGRGLASLDALEKDISSVIEQQKSSMEDGDELLLIIDQPDLLLA
FT                   ATGPSMGIGATEMSEWITALQQHAHATVLTLATDAPLIHNASTSGGLATPIETEHAALV
FT                   IGLAHRARSVMQLRTLDTGAAKDVSGVLRISRGGGLNASEESLEEREALYFIQRDGGVK
FT                   VFGRGES"
     atgccctctc aacccccact accacccctc ctcgctcctt atgtatcaaa tctgcccgat        60
     tcatctctga cactagtgtc ttctatcctt ggtgcaactt caaactggtt gatcttgaga       120
     tttctccatg ctgcgctgag ctcaccgagc cccaacgcgg catttggctc cgacgagctg       180
     cacaatggta caaagaagaa agtagtgctg gtgagcttca tgcggagtta tgagttctgg       240
     aggactgaag caaagcgatt gggccttgat cttgcgcgtc tggcagagaa gcaacaattt       300
     gcattcatag atggcctgtc tgagttgttc tacgcaccgc aacccacagc cacttctccc       360
     agtatctcac cggctggtct gggaagcagt ccacgcacaa cgctcccaat gcggtccccg       420
     cctggtgctg tacctggaag gtcaccacag ccggctgggc caacagccac aggagcgaga       480
     ggaaatgcga cgtcgaagca ggccgaacct gggattgcaa agaagctcca tttctctggt       540
     cgtggtctcg cctccctcga cgcgttggag aaagatatct catcagtgat cgaacaacaa       600
     aagagttcaa tggaagatgg tgatgagctt ctcctcatta tagatcagcc tgacctgctc       660
     ctcgctgcga caggtccgag tatggggatt ggagcaacag agatgtcgga gtggatcaca       720
     gcgctacaac agcatgcaca tgctacggtt ttgacgttag ctacggatgc cccattaata       780
     cacaatgcat ccacgtcggg agggttggct acgccaatag agacggaaca tgcggcactt       840
     gttattgggt tggcgcatcg ggctcggtcg gtcatgcagc tccgcactct ggataccgga       900
     gccgcaaaag atgtgagcgg ggtactgagg atcagccgag gtggtggcct gaacgcgagt       960
     gaagagagcc tggaggagag agaggcgttg tacttcattc aacgggatgg cggtgtcaag      1020
     gtgtttggtc gtggggaatc ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page