(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE300

PENCW_16.PE300       Location/Qualifiers
FT   CDS_pept        join(690393..690425,690498..690527,690589..690683,
FT                   690742..691052,691119..691798,691853..692373,6
FT                   92455..692878)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948853"
FT                   /orf_name="Pc20g03000"
FT                   /product="Pc20g03000 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85629.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831B9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF60"
FT                   /transl_table=1
FT                   /translation="MASTRDSHSFACDECRLRKSRCSKERPVCLQCRQLNKECIYSPKV
FT                   SRSPLTRQHLTYVEDRLHSFETALGRLFPGGDLDATLRSLLQNPEVARAPSSKSSSRHS
FT                   TPKHEPERAEPAPEALPQQADGFDWAEKEITLGDLTDGMAALSIKPEGAGYFGASSSVV
FT                   PLRALFDHGFDLNIPVRSAKSGGVPLKAQLLESAPSGLIEQAFIDAFFLNYHTSYPFIH
FT                   EPTFRMQFNDPSLRPHGTAWHILLNTILALGAWCIGDDSSDLDITFYQEARGYLQQASV
FT                   FETGNLTLVQGLLLLSNYAQKRNKPNTGWNYLGLAVRMAMSLGLHKEFPGWKISLLQRE
FT                   IRRRLWWGVFIFDSGAAKTFGRPILLPEDSVMDAKQVRNIHEEDLTPTTTTLPAESPGP
FT                   TIYSGLIAQASFHLLTNSVYQRLISSPSLTPEDTLNLQKPIEEWYNGLPSYLKHQQLPL
FT                   SMQPANPDPDSLALVRNRLLWRNWNLTILIYRPILLRWAARRWAPLSGSGTATPDAGSE
FT                   DPFETECRLRCLQNARLTISSISDYMANYMCTRLGAWYMLYFLFQAGLIPIVFLMTDPS
FT                   NPEAASWLQDIETTKSLLTHPSLGTNRFATRCLEVINRLLGPPTHPMPQGIPTEGDQLN
FT                   PQHQQQHEHMLPQLQPNMMPFPGQLFSDPGFGGSLFPVEQQMQMHNAGGMDFSEWVNFP
FT                   PAE"
     atggctagca ctcgtgattc ccactcattt gcttgtgacg aatgccgctt gcgcaagtca        60
     agatgctcaa aagagcgacc agtttgtttg caatgccgac agttgaacaa agaatgtata       120
     tacagcccaa aagtcagcag aagtcctctg actcggcaac acttaaccta tgttgaagat       180
     cgcctacact catttgaaac agctttagga aggcttttcc caggaggtga tctggatgct       240
     acactccgtt ctctcttgca aaaccctgag gtggcaaggg ccccttcatc caagtcctct       300
     tcaaggcact caaccccaaa gcatgagcca gaacgtgctg agccagcacc agaagctctc       360
     ccacagcaag ccgatggctt tgactgggcc gaaaaagaga tcacgcttgg tgatttgaca       420
     gacggcatgg ctgcgctgtc tattaaaccc gaaggagctg gctactttgg agcgtcttca       480
     agtgtcgtac cgttacgagc actttttgat catggatttg acttgaatat ccctgttcgc       540
     tccgcaaagt caggtggcgt gcctctcaaa gcacagcttc tggaaagtgc cccatctggg       600
     ctgatcgaac aagcatttat tgacgccttc ttcctcaatt atcacaccag ctatccattt       660
     atccacgagc ctaccttccg gatgcagttt aatgacccat ctctacgccc gcatggtacg       720
     gcctggcata tcctcctaaa tacgatttta gctctgggag cctggtgtat cggcgatgac       780
     agctcagacc tcgatatcac gttctaccaa gaagctagag gatacctgca acaggcatct       840
     gtgtttgaga ctggcaacct gacattagtc caagggttat tgttattgag caactatgca       900
     cagaaacgga acaagcccaa cactggatgg aattatcttg ggttagcagt ccgaatggcc       960
     atgagtttgg gtctccacaa ggagttccct ggctggaaga tcagtctctt acaaagagaa      1020
     atccgcagaa gattgtggtg gggagttttc atcttcgaca gcggcgcagc caaaacattt      1080
     ggaagaccaa ttctcctccc agaggatagt gtcatggatg cgaagcaggt tcgaaatatc      1140
     cacgaagagg atttgacacc cacaacaaca actctgccag ccgagtcgcc cggcccaacc      1200
     atctactccg gcttaattgc tcaggccagc ttccacctcc ttaccaatag tgtctaccaa      1260
     cgcctcatat caagccccag cctcaccccg gaagatacgc tgaacttgca aaaacccatc      1320
     gaagaatggt acaacggtct tccatcatac ctcaaacacc agcagcttcc tctctccatg      1380
     cagccagcca atccagaccc ggactctctc gccctcgtgc gcaaccgcct gctatggcga      1440
     aactggaacc tcaccatttt gatctacaga cctatcctac ttcgctgggc cgctagacgc      1500
     tgggccccac ttagtggcag cggtacagcc actccggatg cagggtctga agatcccttc      1560
     gagacggagt gccgattgcg ctgtctccag aacgcgcggt tgaccatctc ctccatctca      1620
     gattacatgg cgaactatat gtgcacgaga cttggggcat ggtatatgct ctacttcctc      1680
     ttccaagcag ggctcatccc catagtcttc ctaatgaccg acccctcaaa cccagaagcc      1740
     gcctcctggc tccaggacat cgaaaccaca aaatccctcc taacccaccc ctcgctgggc      1800
     acaaaccgct tcgcaacccg ctgcctcgaa gtcatcaacc gactcctcgg cccacccacg      1860
     cacccaatgc cacaaggaat cccaaccgag ggagaccagc tcaacccgca gcaccagcag      1920
     cagcacgagc acatgctccc acaactacag cctaacatga tgccattccc cgggcagctc      1980
     ttcagtgatc ccggattcgg cggaagcctg ttcccagtcg agcagcaaat gcaaatgcac      2040
     aatgcggggg gcatggactt ttctgaatgg gtgaatttcc cgccggcaga atga            2094
//

If you have problems or comments...

PBIL Back to PBIL home page