(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE301

PENCW_16.PE301       Location/Qualifiers
FT   CDS_pept        join(complement(695159..695239),complement(694713..695109),
FT                   complement(694219..694661),complement(694076..694166),
FT                   complement(693717..694022),complement(693551..693647),
FT                   complement(693364..693490),complement(693136..693285))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977849"
FT                   /orf_name="Pc20g03010"
FT                   /product="Pc20g03010 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85630.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831BA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE4"
FT                   /transl_table=1
FT                   /translation="MATIAESSPKGGFALVLQNPFLCGVASFSTLGGLLFGYDQGVISG
FT                   VITMESFGARYPRVFSESGFKGWFVSTLLLAAWAGSLINGPITDRIGRKMSINLAVVVF
FT                   VIGSVIQCAAMNISMLFAGRAIAGLAVGQLTMVVPLYISEVSIPEIRGGLVVLQQLSVT
FT                   LGILFSYWIDYGTNYIGGTRCAPDIPYSGGTISKPTFDPYHDVPAGGCNGQSEVSWRLP
FT                   LALQIVPAVILGIGMLFFPDSPRWLLMKERDDDSLHALSRLRRQDRDSPVLLNEYLEIK
FT                   ASIMLENSFARDNFPNLSGYQLHAAQYMSFFTTWSRFRRLAIGCIVMFFQQFMGCNAMI
FT                   YYAPTIFGQLGLDGNTTSLLATGVYGIVNCLSTLPALFFIDKVGRRPLLMAGAAGTCIS
FT                   LVIVGGILGGFGSSLVSNKSAGWAGIAFIYIYDINFSYSFAPIGWVLPSEIFNLSIRSK
FT                   AISITTSATWMCNFIIGLVTPDMLESITWGTYIFFAAFCLLAFAFTFLCIPETRGKTLE
FT                   DMDLIFGDTAAHEEKKRIKHIEAELRGTPIEEDDLIKPVGSHVEQA"
     atggctacta ttgcagagag ctccccgaag ggcggctttg cgcttgtcct acagaatccc        60
     tttctctgtg gtgtagcatc gttctccacc ctaggtggtc tgttatttgg ctatgatcaa       120
     ggtgtcatta gcggcgttat caccatggag tcctttgggg ctcgatatcc tcgtgtcttt       180
     tctgaaagtg gtttcaaggg ttggtttgtg tcgaccctgt tgcttgcagc ttgggctggt       240
     tccttgatca atggacctat taccgatcgg attggccgaa agatgtccat caacctggct       300
     gtagtggtct tcgtcattgg ttccgttatc cagtgcgctg ctatgaatat ctcaatgctg       360
     ttcgccggtc gagctattgc tggattggct gttggtcaac tgaccatggt ggtgcctctg       420
     tacatttctg aagtttccat tccagagatc cgcggaggac ttgtggtttt acagcaatta       480
     tccgtcactc ttgggatctt gttcagctac tggatcgact atggaacgaa ctacatcggc       540
     ggcaccagat gcgctcctga tatcccatac tctggtggta caatttcaaa gcccaccttc       600
     gacccttatc acgatgttcc tgctggtggc tgcaacgggc agtctgaggt atcatggcgt       660
     ctccccctcg ccctacagat cgttccggct gttatcctcg gtattggaat gctgttcttc       720
     ccagactcgc cccgttggtt gctgatgaaa gagcgtgatg acgattcgct gcacgccctt       780
     tcaagactgc gccgccagga tcgtgacagt cctgttcttc tcaatgagta ccttgaaatc       840
     aaggcttcta ttatgttgga aaactccttt gcgagggaca acttccctaa tctctccgga       900
     taccagttgc acgctgctca gtacatgtcc ttcttcacaa catggtcccg tttcagacgg       960
     ttggccattg gctgcatcgt gatgttcttc caacagttca tgggttgtaa tgccatgatc      1020
     tactatgcac ctacgatctt cggccaactc ggcctggatg gcaacaccac ctccctcctt      1080
     gctactggtg tctacggcat cgtcaactgt cttagcaccc tccccgcgct cttcttcatc      1140
     gacaaagtcg gtcgtcgacc tctgctcatg gcaggcgccg caggaacttg catctcgctg      1200
     gtgattgtgg gcggcatcct gggtggcttt ggttcctcgc tcgtgagcaa taaatccgct      1260
     ggttgggctg gtattgcttt tatctacata tacgatatca acttctccta ttccttcgcc      1320
     cctatcggtt gggttcttcc ttcggagatc ttcaatctct ccattaggtc caaggccatc      1380
     tctatcacga cctcggcaac atggatgtgc aacttcatca ttggccttgt cacgcctgat      1440
     atgctcgagt ccatcacctg gggcacatac atcttctttg ctgccttctg tcttcttgcc      1500
     tttgccttca ccttcctctg catccccgag acccgtggaa agacactcga agatatggat      1560
     ctcattttcg gcgatacagc cgcccacgaa gagaagaagc gcatcaagca cattgaagcc      1620
     gagttacgcg gaacaccgat tgaagaagac gacctcatca agccggtcgg ttcgcatgtg      1680
     gaacaggcat ga                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page