(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE303

PENCW_16.PE303       Location/Qualifiers
FT   CDS_pept        join(complement(699619..699690),complement(699442..699567),
FT                   complement(699221..699234),complement(698693..698953),
FT                   complement(698181..698639),complement(698044..698119))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977850"
FT                   /orf_name="Pc20g03030"
FT                   /product="Pc20g03030 protein"
FT                   /protein_id="CAP85632.1"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="UniParc:UPI0001831BA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE6"
FT                   /transl_table=1
FT                   /translation="MNALSADEMERFQKLSNSYQPDVQGPLVSTKQSSHSIALDYSNAD
FT                   PTLATKTNVSFGGLSLLCYHNIRRMNAWMKLNPNRYQAFLPMPLNQYCSSRIDPVKTEI
FT                   DEVGLQALIDGVIEGSGFGVEILYLDRSEGGAVTPHQLSSDSPSGATIRLLYRPGHYDI
FT                   LYPVEPLNMAPIVNLQYGMTSDYSPWDPTALGFDVNSSLMAIPNLMQDTSFGMGAPMSP
FT                   MPSVSPTPASPFRMSPQQDMYQSPMPTHAAPIPPIPVSPPPQIAPPSSAPPPMTSLPSR
FT                   SSDGPQIRLNPLVMKPNLSRSLPVTTPFKNSPYNQAHFQNSDFEPIHWEPHERR"
     atgaatgcgc tctcggccga cgagatggaa cgcttccaga agctttccaa tagctatcag        60
     ccggatgtcc agggccccct tgtctcaacc aaacaatcta gccacagcat cgcgttggat       120
     tactcaaatg cggatcctac tctagctacg aaaacaaatg taagctttgg tggcttgagc       180
     ctcctgtgtt accacaatat tcggagaatg aacgcgtgga tgaagctcaa tccgaaccgg       240
     taccaggctt tccttcctat gccactgaac cagtactgca gctcgcggat agacccggtg       300
     aagaccgaaa tcgacgaagt tggtcttcaa gcactgatcg acggtgtgat cgaaggctcc       360
     ggctttggtg ttgaaatcct ttacctcgac cgaagtgaag gcggtgccgt cacaccccac       420
     caactatcct ctgacagtcc cagtggtgca accatccgcc tcctgtaccg accaggtcat       480
     tatgatatcc tttacccagt cgaacctttg aatatggcac ccattgtcaa cctccaatac       540
     ggaatgacgt ccgactactc cccctgggat ccaacagccc tcggattcga cgtcaattca       600
     agcttaatgg ccatccccaa tctgatgcag gacacatcct ttgggatggg cgctcccatg       660
     tctccaatgc cttctgtctc gccaaccccc gccagtccat tccgcatgtc cccccaacaa       720
     gacatgtacc aatcgcctat gccaacccat gctgcaccca tcccaccgat tcctgtctct       780
     cctcctccac aaatcgcacc gccatcctcc gccccgccac caatgacttc actgccaagt       840
     cgatcatccg acggcccgca aattcgcctg aatcctttgg tcatgaaacc gaatctcagt       900
     cgctcgttgc cagtcaccac ccctttcaaa aattccccat acaaccaagc ccatttccag       960
     aattctgact ttgaacccat ccattgggaa ccccatgaac gaagataa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page