(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE305

PENCW_16.PE305       Location/Qualifiers
FT   CDS_pept        join(complement(704716..704759),complement(704504..704662),
FT                   complement(704386..704446),complement(703128..704324))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948855"
FT                   /orf_name="Pc20g03050"
FT                   /product="Pc20g03050 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85634.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI0001831BA3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE7"
FT                   /transl_table=1
FT                   /translation="MSDDDDFMQDSGDEDYDFEYEDADEDESGDIGIENKYYNAKQIKV
FT                   DNPEEAVDEFLGIAPMEQDKSDWGFKGLKQAIKLEFKLGRYSDTVAHYRELLTYVKSAV
FT                   TRNYSEKSINNMLDFIEKGSDNAEAYQCMEEFYSLTLESFQNTNNERLWLKTNIKLARL
FT                   WLERKQYGQLGKKVRELHRACQREDGSDDTSKGTYLLELYALEIQMSSETKNNKRLKAL
FT                   YQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWKEAQSDFFESFRNYDEAGSMQRIQV
FT                   LKYLVLTTMLMKSDINPFDSQETKPYKNDPRISAMTDLVDAFQRDDIHAYEDVLSKHPD
FT                   VLADPFIAENIDEVSRNMRTKAVLKLIAPYTRFSLQFISKHIKVSVPEVLDILSFLILD
FT                   KKLNAKIDQDNGTVVVESASDVERLRAVGEWSSALRNLWQTTLNGEGLRANDPSQGSIF
FT                   QSSLLGDEGMRSTRARKDGRGKMPAKWF"
     atgtctgacg atgatgattt tatgcaggat tctggggatg aggattacga cttcgaatat        60
     gaggatgcag acgaggatga gtccggtgac atcgggatcg agaacaaata ctacaatgcc       120
     aagcagatca aggtcgacaa cccagaagag gcagttgacg agttcctggg catagcgccc       180
     atggaacaag acaaaagcga ctggggattc aaaggtctga agcaggccat caagctggaa       240
     ttcaaactcg ggcgatacag cgataccgtc gcacactacc gggaactgct cacatacgtt       300
     aaatccgctg ttacacgaaa ctattcagag aaatcgatca acaatatgct cgacttcatt       360
     gagaaagggt ccgataatgc agaggcgtac caatgcatgg aggaattcta ctctctgacc       420
     ctcgaatcat tccaaaacac aaacaacgag cgcctttggc tgaagacaaa tatcaaactc       480
     gctcggttgt ggctggagcg caagcaatac ggccagttgg gcaagaaggt gcgggaattg       540
     caccgggcat gccaacgaga ggacggatcg gacgacacca gcaaaggaac atacctactc       600
     gagctctacg ccctggagat ccagatgtcc tccgaaacga agaataacaa acgactgaag       660
     gccttgtacc agcgcgccct ccgagtgcgg tcggcagtgc cgcatcccaa gatcatgggc       720
     attatccgtg aatgtggagg caagatgcac atgagcgaag agaactggaa ggaggcacaa       780
     agtgatttct tcgagtcgtt ccgaaactac gacgaggcgg gttccatgca acggatccaa       840
     gtcttgaaat accttgtctt aacgaccatg cttatgaagt ccgacatcaa ccccttcgat       900
     tcgcaggaaa ccaagccata caagaatgat ccacgcattt ccgcgatgac cgacctggtg       960
     gatgccttcc agcgcgacga catccatgca tacgaggacg tgctgagcaa acatccggat      1020
     gtcttggccg atcctttcat tgcggagaac atcgacgagg ttagccgcaa catgcgcacc      1080
     aaggccgttc taaaattgat cgcgccctac acccggtttt cgttgcagtt tatctccaaa      1140
     cacatcaagg tctctgtacc cgaggtgttg gacattctga gtttcctcat ccttgacaaa      1200
     aagctcaacg ccaagattga ccaggataat gggacagtgg tagtggagag tgcgagtgac      1260
     gtggagcggc tgcgagctgt gggagagtgg agctccgcgc tgcgcaacct ctggcaaaca      1320
     actctcaacg gtgaggggtt gcgtgcaaac gatccgtctc agggttccat tttccaatcg      1380
     agtcttcttg gagacgaggg aatgcgatcc acgcgtgcac gcaaggatgg ccgaggcaaa      1440
     atgccagcca aatggttcta g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page