(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE307

PENCW_16.PE307       Location/Qualifiers
FT   CDS_pept        complement(707706..708614)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671923"
FT                   /orf_name="Pc20g03070"
FT                   /product="Pc20g03070 protein"
FT                   /function="octanoyltransferase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /biological_process="protein modification process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85636.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniParc:UPI0001831C7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE9"
FT                   /transl_table=1
FT                   /translation="MRLAHLHLPHTTPFSRVSHLQQTLTTRLLTHKKLASPGSISSQEP
FT                   SNPSATLSKTPPSPPDPTIITFTPNPVYTTGRRDLPPSNTSPPSTTNPILSLPPALEPI
FT                   RSLFTPDGTKPAKAEYHPTLRGGQTTYHGPGQMVAYTILDLKRLGLTPRCHIRVLENSV
FT                   IDLLKSYGVEGFTTEDPGVWVNPVSGSRSASGSALQPRKITAVGVHLRRNISSFGIGLN
FT                   VTDEPMWFFKQIVACGLEGKEATSLQGVGVPGLEVGDVAAAFVEKFVSRVNADFACGEN
FT                   SLGEKIDEVYQVREEDLLNSV"
     atgagacttg cgcacctcca cctcccccac acaacgccct tcagccgcgt ctctcacctc        60
     caacaaaccc tcacaacccg cctcctcacg cacaaaaagc tcgcctcccc aggctcaata       120
     tcctcacaag agccgagcaa cccaagcgcc acactatcca aaacaccacc ctcgccccca       180
     gacccaacaa tcatcacctt caccccaaac cccgtctaca ccaccggccg ccgcgacctc       240
     ccaccttcaa acacaagccc accctccacg acaaacccaa ttctttccct accacctgcc       300
     ctcgaaccaa tccgctccct ctttaccccg gacggcacca aacccgcaaa ggcagagtac       360
     cacccgactc tccgcggcgg acagacaacc taccacgggc cgggccagat ggtcgcgtac       420
     acgattctag atctcaagcg actgggtctc acaccccggt gtcacatccg tgttctagag       480
     aacagcgtca tcgatctact gaaaagctac ggggtggagg ggtttacgac ggaagatccg       540
     ggcgtctggg tgaatcctgt gtcaggatct cgatctgcat ctggatcagc actgcagccg       600
     aggaagatca cggctgtggg ggtgcatctg cgacgcaaca tcagcagctt tggaatcggg       660
     ctgaatgtta cagacgagcc gatgtggttc tttaagcaga ttgtggcttg tgggttggag       720
     ggcaaggagg cgactagtct gcagggtgtg ggggttccgg gattggaagt tggggatgtt       780
     gctgctgcgt ttgtggagaa gtttgtaagt cgggttaatg cggattttgc ttgtggggag       840
     aattcgctgg gggagaagat tgatgaggtt tatcaggtta gggaggagga tttgctgaac       900
     tccgtctag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page