(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE31

PENCW_16.PE31        Location/Qualifiers
FT   CDS_pept        join(complement(75774..75834),complement(75288..75726),
FT                   complement(74982..75226),complement(74747..74934))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19824085"
FT                   /orf_name="Pc20g00310"
FT                   /product="Pc20g00310 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85360.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00018319D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF42"
FT                   /transl_table=1
FT                   /translation="MPVTQSIEREASGSKSQFAPGHKIPVQHLKKPGLQSDLGDPKPVS
FT                   THIPTEDYGYQTYKAAGKLEGKKAIITGGDSGIGRAIAILFAMEGASSVIVYLPEEESD
FT                   AQTTKKRVEEHGQQCHTLAIDLRQKENCRKVINTALEKMGGIDILVNNAAFQDMLSDIS
FT                   ELEESQWEKTFNTNIHSFFYLSKYVLPHMKEGSTIINCASVNPYIGRGDLLDYTSTKGA
FT                   IVAFTRGLSNQQIKKGIRVNCVCPGPIWTPLIPATMQTEAMEQFHAVPIGRPGQPSEVA
FT                   TCFVFLASQDSSYISGQCLHPNGGMMVNG"
     atgcctgtta cccagtctat cgagcgagag gccagtggat ctaaatccca atttgcgcca        60
     ggccacaaga ttcctgttca acacttgaaa aagccgggtc tgcagtccga cttgggagat       120
     cccaagcctg tgtccactca tattcccacc gaggactacg gttaccagac ctacaaagcc       180
     gccgggaagc tcgaaggaaa gaaagcgatt atcaccggtg gtgattccgg aattggtcgg       240
     gcaattgcaa ttctgtttgc aatggagggt gcatcaagtg tcatcgttta cctgccggaa       300
     gaggaatcgg atgcgcaaac gacgaagaag agagttgaag aacatgggca gcagtgccat       360
     actctcgcta tcgacctccg ccagaaggag aattgccgca aggtcatcaa tacggccctg       420
     gaaaagatgg gtggcatcga cattctcgtg aacaacgcgg cgttccaaga catgctgagc       480
     gatatcagtg agctcgagga atcccagtgg gagaagactt ttaataccaa cattcactcc       540
     ttcttttatc tttccaagta tgttcttccg catatgaagg agggatctac catcatcaat       600
     tgcgcatccg tcaatcctta tattggccga ggcgatctcc tggattacac ctcgaccaaa       660
     ggagcaattg tcgcatttac tcgcggcttg tcaaaccagc agataaagaa aggcattcgt       720
     gtcaattgtg tttgcccggg tccaatctgg acacctctga ttcctgcaac aatgcaaacc       780
     gaggccatgg aacaattcca cgcagtgccg attggtcgac ctggtcagcc tagcgaggtc       840
     gcaacatgtt tcgttttcct cgcaagccag gacagcagct atatttccgg acagtgtctg       900
     catcctaacg gcggtatgat ggtcaatgga taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page