(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE310

PENCW_16.PE310       Location/Qualifiers
FT   CDS_pept        join(710950..711607,711668..712152)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671925"
FT                   /orf_name="Pc20g03100"
FT                   /product="Pc20g03100 protein"
FT                   /protein_id="CAP85639.1"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniParc:UPI0001831C81"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF2"
FT                   /transl_table=1
FT                   /translation="MLAPRAARSVRSVTSLLRPFSSSAVAYRAPSIRDITAQSTEEYLR
FT                   RRKEFRENLEQARLKREQQESQSVNASASSSTPSREYAPTAPEVSNASIHDRIYPTFDA
FT                   ATALDQKGLGSLSTHRYLGDDQNQEAAAKRGPLSSLIYGTKEGQHFDKDMERSFSQVLA
FT                   RGKYVHSIVMHDVKPDKVDEYVDLVGQWYPRMAGTEENRVNLVGSWRTQVGDNDTFVHI
FT                   WEYQRYEGYHDSLHNISQHPEFREFDRKLKSLIKSKRTSLMQEFSFWPTTPPRRLGGLF
FT                   ELRSYTLHPGNLLEWETHWRRGLTARREVMEGVGAWFVQIGELNTVHHLWQFANLEERK
FT                   ICREQSWGIEGWAETVHKTVPLIQSMQSRILVPMPWSPVG"
     atgttggctc cacgcgcagc ccgctcagtt cgatcggtga cttcactctt gcgacctttc        60
     agctcgtcag ccgtggccta tcgtgctccc tccattcgag atattacagc gcagtcgact       120
     gaggagtacc tcagacggcg gaaggagttt cgcgagaact tggagcaggc tcgtttgaaa       180
     agagaacagc aagagagtca gtctgtcaat gcttctgctt cttcatctac cccttcccgt       240
     gagtacgctc ccactgctcc agaagtgagc aatgcgagca tccatgatcg tatctaccct       300
     actttcgatg ctgccacggc acttgaccag aaaggactgg gctcactctc aacgcaccgc       360
     tatctagggg atgaccagaa ccaagaagct gcggccaaac gtggcccttt gtcttcgctc       420
     atctacggca ccaaggaggg tcaacacttc gataaggata tggagcgctc gttctcgcag       480
     gtcctagcac gcggcaaata tgtccattct atcgttatgc acgacgtcaa gcccgacaag       540
     gttgatgaat atgtggacct ggtgggccag tggtaccccc gcatggcggg tactgaggag       600
     aaccgtgtca acttggtagg cagctggcgg acgcaagtcg gtgacaacga cacctttgtc       660
     cacatctggg aataccaacg ttacgaaggc taccacgact ctctccacaa catctcgcaa       720
     cacccagagt tccgtgagtt cgatcgcaaa ctcaagagcc tgattaagag caagaggact       780
     tcgttgatgc aggagttctc attctggccc accaccccgc ctcgccgtct cggtggactg       840
     tttgagcttc ggtcgtacac actgcacccg ggaaatctcc tcgagtggga gacgcactgg       900
     cgccgtggcc ttacagctcg tcgtgaggta atggagggcg taggcgcctg gttcgtgcaa       960
     atcggcgaat taaacacagt gcaccacctg tggcagtttg ccaacttgga ggagcgcaag      1020
     atctgccgtg agcagtcgtg gggtatcgag ggctgggccg aaacagttca caaaactgtt      1080
     cctttgatcc agagcatgca gagtcggatt cttgtcccca tgccctggag ccctgtcggc      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page