(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE314

PENCW_16.PE314       Location/Qualifiers
FT   CDS_pept        <718586..719395
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948859"
FT                   /orf_name="Pc20g03140"
FT                   /product="Pc20g03140 protein"
FT                   /protein_id="CAP85643.1"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI0001831C85"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP5"
FT                   /transl_table=1
FT                   /translation="HGYTQSGSLFHAKSRALTKHIQKAFPLHEVTAIYPTAPIRLLPAD
FT                   IPGYEPSSEGGADNEIESYGWWRRSNTANPPLYIGIEEGFATVARTLKQEGPFDGVIGF
FT                   SQGAALAAMVAALLEPGRKASFEQFSKISAEGAAGMTIPAPFGEEGFQHPQLKFAVCYS
FT                   GFRAPGARYRGFYEEPAIQTPVLHVLGSLDAVVEEARSQALVEACAGEPEKDGLVVWHP
FT                   GGHFLPSQRPYLDATVRFIREQMERSDGSNGKGKEVEEDVNDMDLPF"
     cacggctaca cgcagtctgg cagcctcttc cacgccaaaa gccgcgccct gacaaaacac        60
     atccaaaaag ccttccccct ccacgaagtc accgccatct acccgacagc cccaatccgc       120
     ctcctgcccg ccgacatccc aggctacgag ccctcctcgg aaggcggtgc agacaacgaa       180
     atcgaatcct acggctggtg gcgacgctcc aacaccgcaa acccgccgct gtatatcggc       240
     attgaagaag ggttcgcgac tgtagcgcgc acactgaaac aagaaggccc cttcgacggc       300
     gtgatcgggt tctcgcaggg cgctgcgctg gcagccatgg tcgcggcgct gttagagccc       360
     ggccggaagg cgtcattcga gcaattttct aagataagcg ctgagggcgc ggcaggaatg       420
     actattcccg cgccgtttgg cgaggagggc ttccagcatc cgcagcttaa gtttgcggtt       480
     tgttactccg ggttcagggc gcctggggcc cggtacaggg gtttctatga agagcctgct       540
     attcagacgc ctgtgttgca tgtgcttggc tctttggatg ctgttgttga ggaggcgagg       600
     agtcaggctt tggttgaggc ttgtgctggt gagcctgaga aggatgggtt ggttgtttgg       660
     catcctggtg gtcacttttt gccgagtcag cgcccgtatc ttgatgctac tgtgcggttc       720
     attcgggagc agatggagcg cagtgatggc tcgaatggta aggggaagga ggtggaagag       780
     gatgtgaatg atatggattt gccattctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page